Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tesnatilimab Biosimilar – Anti-KLRK1 mAb – Research Grade

  • PX-TA1724-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €190.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tesnatilimab Biosimilar - Anti-KLRK1 mAb - Research Grade

Product name Tesnatilimab Biosimilar - Anti-KLRK1 mAb - Research Grade
Uniprot ID P26718
Source CAS 2242758-08-1
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tesnatilimab,JNJ-64304500, NN8555,NNC142-0002 (HUMAN IGG4 ANTI-NKG2D MONOCLONAL ANTIBODY),KLRK1,anti-KLRK1
Reference PX-TA1724
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4,Kappa
Clonality Monoclonal Antibody
Product name Tesnatilimab Biosimilar - Anti-KLRK1 mAb - Research Grade
Uniprot ID P26718
Source CAS 2242758-08-1
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tesnatilimab,JNJ-64304500, NN8555,NNC142-0002 (HUMAN IGG4 ANTI-NKG2D MONOCLONAL ANTIBODY),KLRK1,anti-KLRK1
Reference PX-TA1724
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4,Kappa
Clonality Monoclonal Antibody
Product name PX-TA1724-50
Uniprot ID P26718
Source CAS 2242758-08-1
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tesnatilimab,JNJ-64304500, NN8555,NNC142-0002 (HUMAN IGG4 ANTI-NKG2D MONOCLONAL ANTIBODY),KLRK1,anti-KLRK1
Reference PX-TA1724
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Tesnatilimab Biosimilar, also known as Anti-KLRK1 mAb, is a monoclonal antibody that has been developed as a potential therapeutic for various diseases. It is a biosimilar of Tesnatilimab, a humanized monoclonal antibody that targets the Killer Cell Lectin-like Receptor Subfamily K Member 1 (KLRK1) protein. In this article, we will discuss the structure, activity, and potential applications of Tesnatilimab Biosimilar as a research grade antibody.

Structure of Tesnatilimab Biosimilar

Tesnatilimab Biosimilar is a recombinant humanized IgG1 monoclonal antibody, with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of the antibody is responsible for its binding specificity to the KLRK1 protein, while the constant region is responsible for its effector functions.

The structure of Tesnatilimab Biosimilar is highly similar to that of Tesnatilimab, with minor differences in the amino acid sequence. This allows Tesnatilimab Biosimilar to have similar binding affinity and specificity to KLRK1, while also having a lower production cost compared to the original antibody.

Activity of Tesnatilimab Biosimilar

The main activity of Tesnatilimab Biosimilar is its ability to bind to the KLRK1 protein, which is expressed on the surface of various immune cells, including natural killer (NK) cells, T cells, and dendritic cells. By binding to KLRK1, Tesnatilimab Biosimilar can modulate the activity of these immune cells, leading to a variety of therapeutic effects.

One of the main mechanisms of action of Tesnatilimab Biosimilar is its ability to enhance the cytotoxicity of NK cells. By binding to KLRK1, the antibody can activate NK cells and promote their killing of target cells, such as tumor cells or virus-infected cells. This makes Tesnatilimab Biosimilar a potential treatment for various types of cancer and viral infections.

Tesnatilimab Biosimilar also has the ability to modulate the activity of T cells, which play a crucial role in the adaptive immune response. By binding to KLRK1, the antibody can either activate or inhibit T cell activity, depending on the context. This makes Tesnatilimab Biosimilar a potential treatment for autoimmune diseases, as well as for enhancing the anti-tumor response of T cells in cancer patients.

Applications of Tesnatilimab Biosimilar

As a research grade antibody, Tesnatilimab Biosimilar has a wide range of potential applications in the field of immunology. It can be used as a tool for studying the role of KLRK1 in various immune processes, such as NK cell cytotoxicity and T cell activation. It can also be used to investigate the potential therapeutic effects of targeting KLRK1 in different disease models.

Tesnatilimab Biosimilar can also be used in pre-clinical studies to assess its safety and efficacy as a potential therapeutic. This can include in vitro and in vivo experiments to evaluate its binding affinity, specificity, and potential side effects. The results of these studies can inform the development of Tesnatilimab Biosimilar as a potential treatment for various diseases.

Conclusion

Tesnatilimab Biosimilar, also known as Anti-KLRK1 mAb, is a promising research grade antibody with potential applications in various fields of immunology. Its structure, activity, and potential therapeutic applications make it an important tool for studying the role of KLRK1 in immune processes and for developing novel treatments for diseases. Further research and clinical trials are needed to fully understand the potential

SEC-HPLC of Tesnatilimab Biosimilar - Anti-CD314;KLRK1 mAb - Research Grade

SEC-HPLC of Tesnatilimab Biosimilar - Anti-CD314;KLRK1 mAb - Research Grade

Tesnatilimab Biosimilar - Anti-CD314;KLRK1 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Tesnatilimab Biosimilar - Anti-KLRK1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tesnatilimab Biosimilar – Anti-KLRK1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products