Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Telimomab Biosimilar – Anti-CD5 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
Fab-nd-nd

Original price was: €179.00.Current price is: €140.00.

50ug 22% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Telimomab Biosimilar - Anti-CD5 mAb - Research Grade

Product name Telimomab Biosimilar - Anti-CD5 mAb - Research Grade
Uniprot ID P06127
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Telimomab,T101-ricin A chain immunotoxin,T101-RTA,CD5 ,anti-CD5
Reference PX-TA1229
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-nd-nd
Clonality Monoclonal Antibody
Product name Telimomab Biosimilar - Anti-CD5 mAb - Research Grade
Uniprot ID P06127
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Telimomab,T101-ricin A chain immunotoxin,T101-RTA,CD5 ,anti-CD5
Reference PX-TA1229
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-nd-nd
Clonality Monoclonal Antibody
Product name PX-TA1229-50
Uniprot ID P06127
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Telimomab,T101-ricin A chain immunotoxin,T101-RTA,CD5 ,anti-CD5
Reference PX-TA1229
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-nd-nd
Clonality Monoclonal Antibody

Telimomab Biosimilar – Anti-CD5 mAb – Research Grade

Telimomab Biosimilar – Anti-CD5 mAb – Research Grade: A Promising Antibody for Therapeutic Targeting

Introduction

Telimomab Biosimilar – Anti-CD5 mAb – Research Grade is a monoclonal antibody (mAb) that has shown great potential in the field of immunotherapy. It is a biosimilar version of Telimomab, a therapeutic antibody that targets the CD5 antigen. This biosimilar form offers a more cost-effective and accessible option for researchers and clinicians to study and utilize in their work.

Structure of Telimomab Biosimilar

Telimomab Biosimilar is a recombinant, humanized mAb that is produced in a mammalian cell expression system. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The heavy and light chains are connected by disulfide bonds and form a Y-shaped structure. The variable regions of the antibody are responsible for binding to the CD5 antigen, while the constant regions mediate effector functions.

Activity of Telimomab Biosimilar

Telimomab Biosimilar specifically targets the CD5 antigen, a glycoprotein that is expressed on the surface of T cells and B cells. CD5 is involved in the regulation of T and B cell activation and differentiation. It is also overexpressed in certain types of cancer cells, making it a potential therapeutic target for cancer treatment.

By binding to the CD5 antigen, Telimomab Biosimilar blocks its function and inhibits the activation and proliferation of T and B cells. This can be beneficial in autoimmune diseases, where the immune system is overactive and attacking healthy cells. It can also be used in cancer treatment, as it can induce cell death in CD5-expressing cancer cells.

Application of Telimomab Biosimilar

Telimomab Biosimilar has several potential applications in the field of immunotherapy. It can be used as a treatment for autoimmune diseases such as rheumatoid arthritis, multiple sclerosis, and psoriasis. By targeting CD5-expressing cells, it can help reduce inflammation and prevent further damage to tissues and organs.

In cancer treatment, Telimomab Biosimilar can be used as a targeted therapy for CD5-positive cancers, including T-cell lymphomas, chronic lymphocytic leukemia, and B-cell lymphomas. It can be used alone or in combination with other treatments to enhance its efficacy.

Furthermore, Telimomab Biosimilar can also be used as a research tool in the development of new therapies and in the study of the CD5 antigen and its role in various diseases. Its biosimilar form allows for easier access and affordability for researchers, making it a valuable resource in the scientific community.

Conclusion

Telimomab Biosimilar – Anti-CD5 mAb – Research Grade is a promising antibody with potential applications in the treatment of autoimmune diseases and cancer. Its specific targeting of the CD5 antigen makes it a valuable tool in immunotherapy and research. With its cost-effective biosimilar form, it offers a more accessible option for scientists and clinicians to utilize in their work. Further studies and clinical trials are needed to fully explore the potential of this antibody and its role in improving human health.

SDS-PAGE for Telimomab Biosimilar - Anti-CD5 mAb - Research Grade

SDS-PAGE for Telimomab Biosimilar - Anti-CD5 mAb - Research Grade

Telimomab Biosimilar - Anti-CD5 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Telimomab Biosimilar - Anti-CD5  mAb - Research Grade

There are no reviews yet.

Be the first to review “Telimomab Biosimilar – Anti-CD5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products