Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sonelokimab Biosimilar – Anti-ALB,IL17A mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
VH-VH'-VH

Original price was: €254.00.Current price is: €200.00.

100ug 21% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Sonelokimab Biosimilar - Anti-ALB,IL17A mAb - Research Grade

Product name Sonelokimab Biosimilar - Anti-ALB,IL17A mAb - Research Grade
Uniprot ID Q16552 & Q96PD4 & P02768
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Sonelokimab ,M-1095,MSB-0010841,ALB,IL17A,anti-ALB,IL17A
Reference PX-TA1606
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VH'-VH
Clonality Monoclonal Antibody
Product name Sonelokimab Biosimilar - Anti-ALB,IL17A mAb - Research Grade
Uniprot ID Q16552 & Q96PD4 & P02768
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Sonelokimab ,M-1095,MSB-0010841,ALB,IL17A,anti-ALB,IL17A
Reference PX-TA1606
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VH'-VH
Clonality Monoclonal Antibody
Product name PX-TA1606-50
Uniprot ID Q16552 & Q96PD4 & P02768
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Sonelokimab ,M-1095,MSB-0010841,ALB,IL17A,anti-ALB,IL17A
Reference PX-TA1606
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VH'-VH
Clonality Monoclonal Antibody

Introduction

Sonelokimab is a biosimilar antibody that targets the protein ALB and interleukin-17A (IL-17A). It is a research grade antibody that has shown promising results in preclinical studies and is currently being evaluated in clinical trials for its potential therapeutic applications. In this article, we will discuss the structure, activity, and potential applications of Sonelokimab as an anti-ALB, IL-17A monoclonal antibody.

Structure of Sonelokimab

Sonelokimab is a monoclonal antibody, meaning it is produced by identical immune cells and is specific for a single target. It is a humanized antibody, which means it is derived from non-human sources but has been modified to be more similar to human antibodies. Sonelokimab specifically targets the protein ALB and IL-17A, which are both involved in inflammatory processes.

The antibody has a Y-shaped structure, with two identical heavy chains and two identical light chains. The heavy chains are responsible for binding to the target protein, while the light chains help to stabilize the antibody’s structure. The binding site of Sonelokimab is located at the Fab region, which is the variable region of the antibody that recognizes and binds to its target.

Mechanism of Action

Sonelokimab works by binding to the protein ALB and IL-17A, preventing them from interacting with their respective receptors. This blocks the signaling pathways that lead to inflammation and immune response. By targeting both ALB and IL-17A, Sonelokimab has a dual mechanism of action, making it a potentially more effective therapeutic agent.

ALB is a protein involved in the regulation of the immune response and has been linked to various inflammatory diseases, such as rheumatoid arthritis and psoriasis. IL-17A is a pro-inflammatory cytokine that plays a crucial role in the development of autoimmune diseases. By inhibiting the activity of both ALB and IL-17A, Sonelokimab can potentially reduce inflammation and alleviate symptoms associated with these diseases.

Potential Applications

Sonelokimab has shown promising results in preclinical studies, and it is currently being evaluated in clinical trials for its potential therapeutic applications. Some of the diseases that Sonelokimab could potentially treat include rheumatoid arthritis, psoriasis, and inflammatory bowel disease.

In a preclinical study, Sonelokimab demonstrated a significant reduction in the severity of symptoms in a mouse model of rheumatoid arthritis. It also showed efficacy in reducing skin inflammation and psoriasis-like lesions in a mouse model of psoriasis. These results suggest that Sonelokimab could potentially be an effective treatment for these inflammatory diseases in humans.

In addition, Sonelokimab has also shown promise in the treatment of inflammatory bowel disease, specifically ulcerative colitis. In a phase 2 clinical trial, patients with moderate to severe ulcerative colitis who received Sonelokimab showed a significant improvement in their symptoms compared to those who received a placebo. This suggests that Sonelokimab could be a potential treatment option for this debilitating condition.

Conclusion

Sonelokimab is a biosimilar antibody that targets the proteins ALB and IL-17A, which are involved in inflammatory processes. Its dual mechanism of action makes it a potentially more effective therapeutic agent for diseases such as rheumatoid arthritis, psoriasis, and inflammatory bowel disease. With promising results in preclinical studies and ongoing clinical trials, Sonelokimab could potentially provide a new treatment option for patients suffering from these inflammatory diseases.

SDS-PAGE for Sonelokimab Biosimilar - Anti-ALB,IL17A mAb - Research Grade

SDS-PAGE for Sonelokimab  Biosimilar - Anti-ALB,IL17A mAb - Research Grade

Sonelokimab Biosimilar - Anti-ALB,IL17A mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Sonelokimab  Biosimilar - Anti-ALB,IL17A mAb - Research Grade

There are no reviews yet.

Be the first to review “Sonelokimab Biosimilar – Anti-ALB,IL17A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products