Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

SIGLEC2 recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P20273
Molecular weight:
19.57 kDa

Original price was: €362.00.Current price is: €329.00.

100ug 9% OFF + 329 loyalty points
His Trp176–Ala330
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

SIGLEC2 recombinant protein

Product name PX-P5177-100
Uniprot ID P20273
Uniprot link https://www.uniprot.org/uniprot/P20273
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence WLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYA
Molecular weight 19.57 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Trp176-Ala330
Protein Accession P20273
Aliases /Synonyms Sialic acid-binding Ig-like lectin 2, Siglec-2, CD22, T-cell surface antigen Leu-14, BL-CAM, B-lymphocyte cell adhesion molecule, B-cell receptor CD22
Reference PX-P5177
Note For research use only
Molecular Constructor
His Trp176–Ala330
Product name PX-P5177-1MG
Uniprot ID P20273
Uniprot link https://www.uniprot.org/uniprot/P20273
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence WLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYA
Molecular weight 19.57 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Trp176-Ala330
Protein Accession P20273
Aliases /Synonyms Sialic acid-binding Ig-like lectin 2, Siglec-2, CD22, T-cell surface antigen Leu-14, BL-CAM, B-lymphocyte cell adhesion molecule, B-cell receptor CD22
Reference PX-P5177
Note For research use only
Molecular Constructor
His Trp176–Ala330
Product name PX-P5177-50
Uniprot ID P20273
Uniprot link https://www.uniprot.org/uniprot/P20273
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence WLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYA
Molecular weight 19.57 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Trp176-Ala330
Protein Accession P20273
Aliases /Synonyms Sialic acid-binding Ig-like lectin 2, Siglec-2, CD22, T-cell surface antigen Leu-14, BL-CAM, B-lymphocyte cell adhesion molecule, B-cell receptor CD22
Reference PX-P5177
Note For research use only
Molecular Constructor
His Trp176–Ala330

General information on SIGLEC2 recombinant protein

SIGLEC2 Recombinant Protein: Structure and Activity

SIGLEC2 is a member of the CD family of proteins, which are transmembrane receptors that recognize and bind to the sialic acid molecules found on the surface of cells. SIGLEC2 is expressed on the surface of B cells, monocytes, and macrophages, and is involved in immune cell signaling and regulation. The recombinant form of SIGLEC2 is a soluble protein that has been overexpressed in a recombinant expression system. This protein contains a single transmembrane domain and an extracellular domain, which is composed of two immunoglobulin-like domains.

SIGLEC2 Recombinant Protein: Application

The recombinant form of SIGLEC2 can be used in a variety of research applications, including functional assays, immunoassays, and antibody-drug target studies. In functional assays, the recombinant protein can be used to study the interactions between SIGLEC2 and its ligands, such as sialic acid. In immunoassays, the protein can be used to detect and quantify the presence of SIGLEC2 on the surface of cells. Finally, the recombinant protein can be used in antibody-drug target studies to investigate the potential of SIGLEC2 as a therapeutic target.

SIGLEC2 recombinant protein

There are no reviews yet.

Be the first to review “SIGLEC2 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products