Brand: ProteoGenix

ITGA4 recombinant protein

PX-P5178-100
Validated ELISA

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: P13612
Molecular weight:: 33.20 kDa

Original price was: €322.00.Current price is: €275.00.

100ug 15% OFF + 275 loyalty points

His-tag Asn35–Leu315

Size Size

50ug Original price was: €224.00.Current price is: €193.00.
100ug Original price was: €322.00.Current price is: €275.00.
1MG Original price was: €966.00.Current price is: €798.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

ITGA4 recombinant protein

Product name	PX-P5178-100
Uniprot ID	P13612
Uniprot link	https://www.uniprot.org/uniprot/P13612
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	NVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGKKLGSYFGASVCAVDL
Molecular weight	33.20 kDa
Protein delivered with Tag?	N-terminal His-tag
Purity estimated	>90% as determined by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Asn35-Leu315
Protein Accession	P13612
Aliases /Synonyms	VLA-4 Subunit Alpha ,CD49 Antigen-Like Family Member D,Integrin Subunit Alpha 4, CD49D
Reference	PX-P5178
Note	For research use only.
Molecular Constructor	His-tag Asn35–Leu315

Product name	PX-P5178-1MG
Uniprot ID	P13612
Uniprot link	https://www.uniprot.org/uniprot/P13612
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	NVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGKKLGSYFGASVCAVDL
Molecular weight	33.20 kDa
Protein delivered with Tag?	N-terminal His-tag
Purity estimated	>90% as determined by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Asn35-Leu315
Protein Accession	P13612
Aliases /Synonyms	VLA-4 Subunit Alpha ,CD49 Antigen-Like Family Member D,Integrin Subunit Alpha 4, CD49D
Reference	PX-P5178
Note	For research use only.
Molecular Constructor	His-tag Asn35–Leu315

Product name	PX-P5178-50
Uniprot ID	P13612
Uniprot link	https://www.uniprot.org/uniprot/P13612
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	NVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGKKLGSYFGASVCAVDL
Molecular weight	33.20 kDa
Protein delivered with Tag?	N-terminal His-tag
Purity estimated	>90% as determined by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Asn35-Leu315
Protein Accession	P13612
Aliases /Synonyms	VLA-4 Subunit Alpha ,CD49 Antigen-Like Family Member D,Integrin Subunit Alpha 4, CD49D
Reference	PX-P5178
Note	For research use only.
Molecular Constructor	His-tag Asn35–Leu315

Natalizumab Biosimilar - Anti-ITGA4, CD49d mAb - Research Grade binds to Human ITGA4 recombinant protein in indirect ELISA Assay

Immobilized Human ITGA4 recombinant protein(cat. No.PX-P5178) at 4µg/mL (100µL/well) can bind to Natalizumab Biosimilar - Anti-ITGA4, CD49d mAb - Research Grade (cat. No.PX-TA1053) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450