Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-CD22 Polyclonal Antibody

  • PTX19612-50
  • Validated WB
Clonality:
Polyclonal Antibody

Original price was: €162.00.Current price is: €118.00.

50ug 27% OFF + 118 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-CD22 Polyclonal Antibody binds to Human CD22 recombinant protein in WB Assay

Anti-CD22 Polyclonal Antibody

Product name PTX19612-100
Uniprot ID P20273
Raw Antigen Sequence WLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYA
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Aliases /Synonyms Anti-CD22, Anti-Siglec-2, Anti-BL-CAM
Clonality Polyclonal Antibody
Product name PTX19612-1MG
Uniprot ID P20273
Raw Antigen Sequence WLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYA
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Aliases /Synonyms Anti-CD22, Anti-Siglec-2, Anti-BL-CAM
Clonality Polyclonal Antibody
Product name PTX19612-50
Uniprot ID P20273
Raw Antigen Sequence WLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYA
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Aliases /Synonyms Anti-CD22, Anti-Siglec-2, Anti-BL-CAM
Clonality Polyclonal Antibody

Anti-CD22 Polyclonal Antibody binds to Human CD22 recombinant protein in WB Assay

Anti-CD22 Polyclonal Antibody binds to Human CD22 recombinant protein in WB Assay

Human CD22 recombinant protein(cat. No.PX-P6369) can bind Anti-CD22 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-CD22 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products