Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Serrumab Biosimilar – Anti-scorpion venom mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €492.00.Current price is: €370.00.

100ug 25% OFF + 370 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Serrumab Biosimilar - Anti-scorpion venom mAb - Research Grade

Product name Serrumab Biosimilar - Anti-scorpion venom mAb - Research Grade
Uniprot ID P15226
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MKGMILFISCLLLIGIVVECKEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKCGKK
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-scorpion venom
Reference PX-TA2027
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Serrumab Biosimilar - Anti-scorpion venom mAb - Research Grade
Uniprot ID P15226
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MKGMILFISCLLLIGIVVECKEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKCGKK
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-scorpion venom
Reference PX-TA2027
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA2027-50
Uniprot ID P15226
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MKGMILFISCLLLIGIVVECKEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKCGKK
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-scorpion venom
Reference PX-TA2027
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Serrumab Biosimilar, also known as Anti-scorpion venom mAb – Research Grade, is a monoclonal antibody (mAb) that has been developed as a biosimilar to the therapeutic antibody Serrumab. This biosimilar has been designed to target and neutralize the effects of scorpion venom, providing a potential treatment for scorpion envenomation.

Structure of Serrumab Biosimilar

Serrumab Biosimilar is a recombinant humanized IgG1 monoclonal antibody, with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions are responsible for binding to the target, while the constant regions determine the effector functions of the antibody.

Activity of Serrumab Biosimilar

Serrumab Biosimilar has been specifically designed to target and bind to a protein in scorpion venom called venom-specific ion channel (VSIC). This protein is responsible for the toxic effects of scorpion venom, including pain, inflammation, and cardiovascular and respiratory complications.

Once bound to VSIC, Serrumab Biosimilar blocks its activity, preventing the release of neurotransmitters and reducing the severity of the symptoms caused by scorpion envenomation. This mechanism of action makes Serrumab Biosimilar a potential therapeutic option for treating scorpion stings.

Application of Serrumab Biosimilar

Serrumab Biosimilar has been developed for research purposes and is not currently approved for clinical use. However, it has shown promising results in preclinical studies and is being further evaluated for its potential as a therapeutic option for scorpion envenomation.

One of the main applications of Serrumab Biosimilar is in the development of antivenoms. Traditional antivenoms are produced by immunizing animals with scorpion venom and collecting the antibodies produced by their immune systems. However, this process is time-consuming, expensive, and can lead to adverse reactions in some individuals. Serrumab Biosimilar, on the other hand, can be produced in large quantities through recombinant technology, making it a more efficient and cost-effective alternative for antivenom production.

Another potential application of Serrumab Biosimilar is in the treatment of scorpion envenomation in humans. Clinical trials are currently underway to evaluate the safety and efficacy of this biosimilar as a therapeutic option for scorpion stings. If successful, Serrumab Biosimilar could provide a much-needed treatment for this potentially life-threatening condition.

Conclusion

In summary, Serrumab Biosimilar is a recombinant humanized monoclonal antibody that has been developed as a biosimilar to the therapeutic antibody Serrumab. It targets and neutralizes the effects of scorpion venom by binding to the venom-specific ion channel, providing a potential treatment option for scorpion envenomation. With further research and clinical trials, Serrumab Biosimilar has the potential to revolutionize the treatment of scorpion stings and improve outcomes for those affected by this condition.

SDS-PAGE for Research Grade Serrumab

SDS-PAGE for Research Grade Serrumab

Research Grade Serrumab, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Serrumab Biosimilar - Anti-scorpion venom mAb - Research Grade

There are no reviews yet.

Be the first to review “Serrumab Biosimilar – Anti-scorpion venom mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products