Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rolinsatamab Biosimilar – Anti-PRLR mAb – Research Grade

  • PX-TA1535-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €168.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Rolinsatamab Biosimilar - Anti-PRLR mAb - Research Grade

Product name Rolinsatamab Biosimilar - Anti-PRLR mAb - Research Grade
Uniprot ID P16471
Source CAS 2095467-30-2
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Rolinsatamab,PR-1594804,h16f,PRLR,anti-PRLR
Reference PX-TA1535
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Rolinsatamab Biosimilar - Anti-PRLR mAb - Research Grade
Uniprot ID P16471
Source CAS 2095467-30-2
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Rolinsatamab,PR-1594804,h16f,PRLR,anti-PRLR
Reference PX-TA1535
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1535-50
Uniprot ID P16471
Source CAS 2095467-30-2
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Rolinsatamab,PR-1594804,h16f,PRLR,anti-PRLR
Reference PX-TA1535
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Rolinsatamab Biosimilar, also known as Anti-PRLR mAb, is a research grade monoclonal antibody that specifically targets the prolactin receptor (PRLR). This antibody has been developed as a biosimilar to the original Rolinsatamab, with the aim of providing a more cost-effective and accessible option for research purposes. In this article, we will explore the structure, activity, and potential applications of Rolinsatamab Biosimilar in the field of antibody-based therapeutics.

Structure of Rolinsatamab Biosimilar

Rolinsatamab Biosimilar is a recombinant humanized IgG1 monoclonal antibody that has been engineered to have a high affinity for the PRLR. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions are responsible for binding to the PRLR, while the constant regions are responsible for mediating effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Rolinsatamab Biosimilar

The primary activity of Rolinsatamab Biosimilar is its ability to bind to and block the PRLR. The PRLR is a transmembrane receptor that is expressed on the surface of various cell types, including breast, prostate, and ovarian cancer cells. Binding of prolactin to the PRLR activates downstream signaling pathways that promote cell growth and survival. By blocking the PRLR, Rolinsatamab Biosimilar inhibits these pathways and ultimately suppresses the growth and survival of cancer cells.

In addition to its blocking activity, Rolinsatamab Biosimilar also has effector functions that can contribute to its anti-tumor effects. Upon binding to the PRLR, the antibody can recruit immune cells, such as natural killer (NK) cells, to the site of the tumor. These immune cells can then induce cell death through ADCC or CDC, further enhancing the anti-tumor activity of Rolinsatamab Biosimilar.

Applications of Rolinsatamab Biosimilar

As a biosimilar to Rolinsatamab, this antibody has the potential to be used in a variety of research applications. One of the main applications is in the field of cancer research, where the PRLR is known to play a role in promoting tumor growth and progression. By targeting the PRLR, Rolinsatamab Biosimilar can be used to study the effects of blocking this receptor on cancer cell growth and survival. It can also be used in combination with other anti- cancer therapies to assess its potential as a therapeutic agent.

In addition to cancer research, Rolinsatamab Biosimilar may also have applications in other disease areas where the PRLR is involved, such as autoimmune disorders and reproductive disorders. By targeting the PRLR, this antibody may have the potential to modulate immune responses and hormone signaling, respectively, in these diseases.

Conclusion

In summary, Rolinsatamab Biosimilar is a research grade monoclonal antibody that specifically targets the PRLR. Its structure, activity, and potential applications make it a valuable tool for studying the role of the PRLR in various diseases, particularly cancer. As a biosimilar, it offers a more cost-effective and accessible option for researchers interested in studying the PRLR pathway. Continued research and development of Rolinsatamab Biosimilar may lead to its potential use as a therapeutic agent in the future.

SDS-PAGE for Rolinsatamab Biosimilar - Anti-PRLR mAb - Research Grade

SDS-PAGE for Rolinsatamab Biosimilar - Anti-PRLR mAb - Research Grade

Rolinsatamab Biosimilar - Anti-PRLR mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Rolinsatamab Biosimilar - Anti-PRLR mAb - Research Grade

SEC-HPLC of Rolinsatamab Biosimilar - Anti-PRLR mAb - Research Grade

Rolinsatamab Biosimilar - Anti-PRLR mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Rolinsatamab Biosimilar - Anti-PRLR mAb - Research Grade

There are no reviews yet.

Be the first to review “Rolinsatamab Biosimilar – Anti-PRLR mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products