Integrin beta-1(ITGB1)

Reference:
Product nameIntegrin beta-1(ITGB1)
Uniprot IDP05556
Uniprot linkhttps://www.uniprot.org/uniprot/P05556
Origin speciesHomo sapiens (Human)
Expression systemProcaryotic expression
SequenceQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKN KNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKS LGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELV GKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMY TMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSS EVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTE EVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEI CSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDT STCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYF NITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPD
Molecular weight78.36 kDa
Protein delivered with Tag?N terminus His tag
Purity estimated>90% by SDS-PAGE
BufferPBS pH 7.5, 0.02% SKL
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeGln21-Asp728
Protein AccessionP05556
Spec:Entrez GeneID3688
Spec:NCBI Gene AliasesCD29; FNRB; MDF2; VLAB; GPIIA; MSK12; VLA-BETA
Spec:SwissProtIDQ8WUM6
NCBI ReferenceP05556
Aliases /SynonymsFibronectin receptor subunit beta,Glycoprotein IIa,GPIIA,VLA-4 subunit beta,CD_antigen: CD29,FNRB, MDF2, MSK12
ReferencePX-P4798
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Integrin beta-1(ITGB1)”

Your email address will not be published. Required fields are marked *

Related products

Anti His tag mouse monoclonal antibody
Tag Antibody Anti His tag mouse monoclonal antibody PTX17851-100 180€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.