Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rilonacept Biosimilar – Anti-Interleukin-1 beta fusion protein – Research Grade

Uniprot ID:
P01584

Original price was: €192.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Rilonacept Biosimilar - Anti-Interleukin-1 beta fusion protein - Research Grade

Product name Rilonacept Biosimilar - Anti-Interleukin-1 beta fusion protein - Research Grade
Uniprot ID P01584
Expression system XtenCHO
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Interleukin-1 beta, IL1B, Catabolin, IL1F2, IL-1 beta
Reference PX-TA2021
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IL1RAP (interleukin-1 receptor accessory protein) - IL1R1 (type 1 interleukin-1 receptor, interleukin 1 receptor, type I)]2 - IGHG1 Fc (Fragment constant)
Product name Rilonacept Biosimilar - Anti-Interleukin-1 beta fusion protein - Research Grade
Uniprot ID P01584
Expression system XtenCHO
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Interleukin-1 beta, IL1B, Catabolin, IL1F2, IL-1 beta
Reference PX-TA2021
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IL1RAP (interleukin-1 receptor accessory protein) - IL1R1 (type 1 interleukin-1 receptor, interleukin 1 receptor, type I)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA2021-50
Uniprot ID P01584
Expression system XtenCHO
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Interleukin-1 beta, IL1B, Catabolin, IL1F2, IL-1 beta
Reference PX-TA2021
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IL1RAP (interleukin-1 receptor accessory protein) - IL1R1 (type 1 interleukin-1 receptor, interleukin 1 receptor, type I)]2 - IGHG1 Fc (Fragment constant)

Introduction to Rilonacept Biosimilar

Rilonacept Biosimilar is a biologic drug that is designed to mimic the structure and function of the human protein interleukin-1 beta (IL-1β). It is a fusion protein, meaning it is made up of two different proteins that have been joined together. This biosimilar is a research grade version of the drug, meaning it is intended for use in laboratory research and not for clinical use.

Structure of Rilonacept Biosimilar

Rilonacept Biosimilar is a fusion protein composed of two parts: the extracellular domain of the human IL-1β receptor and the Fc portion of a human antibody. The extracellular domain of the IL-1β receptor is responsible for binding to IL-1β, while the Fc portion of the antibody provides stability and prolongs the half-life of the drug in the body.

The IL-1β receptor is a transmembrane protein that is found on the surface of cells. It is composed of three subunits: IL-1R1, IL-1R3, and IL-1RAcP. The extracellular domain of the receptor is responsible for binding to IL-1β, while the intracellular domain activates signaling pathways within the cell.

Activity of Rilonacept Biosimilar

Rilonacept Biosimilar works by binding to IL-1β and preventing it from interacting with the IL-1β receptor on cells. This prevents the activation of signaling pathways and the subsequent inflammatory response that IL-1β is known to cause.

IL-1β is a pro-inflammatory cytokine that is involved in a variety of immune and inflammatory responses. It is produced by immune cells in response to infection, injury, or other stimuli. However, excessive or prolonged production of IL-1β can lead to chronic inflammation and tissue damage.

By blocking the activity of IL-1β, Rilonacept Biosimilar has the potential to alleviate symptoms of inflammatory diseases such as rheumatoid arthritis, gout, and cryopyrin-associated periodic syndromes. It may also have applications in treating other conditions where IL-1β plays a role, such as cardiovascular disease and certain types of cancer.

Therapeutic Target of Rilonacept Biosimilar

The therapeutic target of Rilonacept Biosimilar is IL-1β, specifically its interaction with the IL-1β receptor. By targeting this specific interaction, the drug is able to block the activity of IL-1β without affecting other cytokines or immune functions.

The IL-1β receptor has been identified as a potential therapeutic target for a variety of inflammatory diseases. However, previous attempts at targeting this receptor have been hindered by the complexity and variability of IL-1β signaling. Rilonacept Biosimilar offers a more targeted approach by specifically blocking the binding of IL-1β to the receptor.

Application of Rilonacept Biosimilar

Rilonacept Biosimilar is currently being studied for its potential therapeutic applications in various inflammatory diseases. It is also being used in laboratory research to better understand the role of IL-1β in these diseases and to identify potential new targets for drug development.

In addition to its potential as a therapeutic agent, Rilonacept Biosimilar may also have applications in diagnostics and biomarker discovery. By selectively blocking the activity of IL-1β, researchers can study the effects of this cytokine on different cell types and in different disease states.

Conclusion

In summary, Rilonacept Biosimilar is a fusion protein designed to mimic the structure and function of the human protein IL-1β. It works by blocking the interaction between IL-1β and its receptor, thereby preventing the inflammatory response caused by IL-1β. This biosimilar has the potential to be used as a therapeutic agent for various inflammatory diseases and is also a valuable tool for research in this field.

Rilonacept Biosimilar - Anti-Interleukin-1 beta fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Rilonacept Biosimilar – Anti-Interleukin-1 beta fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products