Rhesus monkey TAFA2 Recombinant Protein

Reference:
Product nameRhesus monkey TAFA2 Recombinant Protein
Uniprot IDG7N7I3
Uniprot linkhttp://www.uniprot.org/uniprot/G7N7I3
Origin speciesRhesus monkey
Expression systemProcaryotic expression
SequenceMAHNHRHKHKLDDDDKANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKW WCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH
Molecular weight13,16 kDa
Protein delivered with Tag?Yes
Purity estimated80% native (degradation + contaminant) >95% denatured
BufferPBS, imidazole 300mM in natives conditions. PBS, imidazole 10mM, Urea 8M in denaturing conditions
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionEHH20918.1
Spec:SwissProtIDF6PPL1
NCBI ReferenceEHH20918.1
Aliases /SynonymsTAFA2, Chemokine-like protein TAFA-2
ReferencePX-P1158
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Rhesus monkey TAFA2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.