Brand: ProteoGenix

ESAT-6-like protein EsxB(esxB)

PX-P4332-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Uniprot ID:: P9WNK5
Molecular weight:: 37.27kDa

€182.00

50ug + 182 loyalty points

Met1–Phe100

size size

50ug €182.00
100ug €329.00

Clear

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

ESAT-6-like protein EsxB(esxB)

Product name	ESAT-6-like protein EsxB(esxB)
Uniprot ID	P9WNK5
Uniprot link	https://www.uniprot.org/uniprot/P9WNK5
Expression system	Prokaryotic expression
Sequence	MGPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPMAEMKTDAATLA QEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQ ALSSQMGF
Molecular weight	37.27kDa
Purity estimated	>70% by SDS-PAGE
Buffer	TBS pH8.0
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Phe100
Aliases /Synonyms	cfp10, lhp,10 kDa culture filtrate antigen CFP-10,CFP-10,Secreted antigenic protein MTSA-10
Reference	PX-P4332
Note	For research use only
Molecular Constructor	Met1–Phe100

Product name	ESAT-6-like protein EsxB(esxB)
Uniprot ID	P9WNK5
Uniprot link	https://www.uniprot.org/uniprot/P9WNK5
Expression system	Prokaryotic expression
Sequence	MGPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPMAEMKTDAATLA QEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQ ALSSQMGF
Molecular weight	37.27kDa
Purity estimated	>70% by SDS-PAGE
Buffer	TBS pH8.0
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Phe100
Aliases /Synonyms	cfp10, lhp,10 kDa culture filtrate antigen CFP-10,CFP-10,Secreted antigenic protein MTSA-10
Reference	PX-P4332
Note	For research use only
Molecular Constructor	Met1–Phe100

General information on ESAT-6-like protein EsxB (esxB):

The ESAT6 antigen of Mycobacterium tuberculosis is the main target of the cellular environmental immunity of tuberculosis (TB) cells in the early stage of patients with tuberculosis (TB) and of several animal models. ESAT6 was not found in Mycobacterium bovis BCG. Its function is unknown, but it causes high levels of IFNγ in effector memory cells in the first stage of a protective immune response.

There are no reviews yet.

Be the first to review “ESAT-6-like protein EsxB(esxB)”

ESAT-6-like protein EsxB(esxB)

ESAT-6-like protein EsxB(esxB)

General information on ESAT-6-like protein EsxB (esxB):

Recently viewed products

Can’t find what you need?

Cart (0 Items)

ESAT-6-like protein EsxB(esxB)

Specifications ESAT-6-like protein EsxB(esxB)

Description

General information on ESAT-6-like protein EsxB (esxB):

Documents

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

ESAT-6-like protein EsxB(esxB)