Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Early secreted antigenic target 6 kDa (esxA)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P9WNK6
Molecular weight:
33.87kDa

Original price was: €202.00.Current price is: €182.00.

50ug 10% OFF + 182 loyalty points
GST Met1–Gln70
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Early secreted antigenic target 6 kDa (esxA)

Product name Early secreted antigenic target 6 kDa (esxA)
Uniprot ID P9WNK6
Uniprot link https://www.uniprot.org/uniprot/P9WNK6
Expression system Prokaryotic expression
Raw Antigen Sequence MGPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQ*
Molecular weight 33.87kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >20% by SDS-PAGE
Buffer TBS, pH8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gln70
Protein Accession P9WNK6
Spec:SwissProtID Q540D8
NCBI Reference P9WNK6
Aliases /Synonyms ESXA_MYCTO
Reference PX-P4753
Note For research use only
Molecular Constructor
GST Met1–Gln70
Product name Early secreted antigenic target 6 kDa (esxA)
Uniprot ID P9WNK6
Uniprot link https://www.uniprot.org/uniprot/P9WNK6
Expression system Prokaryotic expression
Raw Antigen Sequence MGPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQ*
Molecular weight 33.87kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >20% by SDS-PAGE
Buffer TBS, pH8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gln70
Protein Accession P9WNK6
Spec:SwissProtID Q540D8
NCBI Reference P9WNK6
Aliases /Synonyms ESXA_MYCTO
Reference PX-P4753
Note For research use only
Molecular Constructor
GST Met1–Gln70
Product name PX-P4753-1MG
Uniprot ID P9WNK6
Uniprot link https://www.uniprot.org/uniprot/P9WNK6
Expression system Prokaryotic expression
Raw Antigen Sequence MGPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQ*
Molecular weight 33.87kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >20% by SDS-PAGE
Buffer TBS, pH8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gln70
Protein Accession P9WNK6
Spec:SwissProtID Q540D8
NCBI Reference P9WNK6
Aliases /Synonyms ESXA_MYCTO
Reference PX-P4753
Note For research use only
Molecular Constructor
GST Met1–Gln70

Early secreted antigenic target 6 kDa (esxA)

There are no reviews yet.

Be the first to review “Early secreted antigenic target 6 kDa (esxA)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products