Name: Early secreted antigenic target 6 kDa (esxA)
SKU: PX-P4753-10
Availability: InStock

Product name	Early secreted antigenic target 6 kDa (esxA)
Uniprot ID	P9WNK6
Uniprot link	https://www.uniprot.org/uniprot/P9WNK6
Expression system	Prokaryotic expression
Sequence	MGPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQ*
Molecular weight	33.87kDa
Protein delivered with Tag?	N-terminal GST Tag
Purity estimated	>20% by SDS-PAGE
Buffer	TBS, pH8.0
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Met1-Gln70
Protein Accession	P9WNK6
Spec:SwissProtID	Q540D8
NCBI Reference	P9WNK6
Aliases /Synonyms	ESXA_MYCTO
Reference	PX-P4753
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Early secreted antigenic target 6 kDa (esxA)”

size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17859 180€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.