Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Early secreted antigenic target 6 kDa (esxA)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P9WNK6
Molecular weight:
33.87kDa

€182.00

50ug + 182 loyalty points
GST Met1–Gln70
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Early secreted antigenic target 6 kDa (esxA)

Early secreted antigenic target 6 kDa (esxA)

Product name Early secreted antigenic target 6 kDa (esxA)
Uniprot ID P9WNK6
Uniprot link https://www.uniprot.org/uniprot/P9WNK6
Expression system Prokaryotic expression
Sequence MGPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQ*
Molecular weight 33.87kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >20% by SDS-PAGE
Buffer TBS, pH8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gln70
Protein Accession P9WNK6
Spec:SwissProtID Q540D8
NCBI Reference P9WNK6
Aliases /Synonyms ESXA_MYCTO
Reference PX-P4753
Note For research use only
Molecular Constructor
GST Met1–Gln70
Product name Early secreted antigenic target 6 kDa (esxA)
Uniprot ID P9WNK6
Uniprot link https://www.uniprot.org/uniprot/P9WNK6
Expression system Prokaryotic expression
Sequence MGPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQ*
Molecular weight 33.87kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >20% by SDS-PAGE
Buffer TBS, pH8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gln70
Protein Accession P9WNK6
Spec:SwissProtID Q540D8
NCBI Reference P9WNK6
Aliases /Synonyms ESXA_MYCTO
Reference PX-P4753
Note For research use only
Molecular Constructor
GST Met1–Gln70

There are no reviews yet.

Be the first to review “Early secreted antigenic target 6 kDa (esxA)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products