Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse SIGLEC10/SLG2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q80ZE3
Molecular weight:
59.57 kDa

Original price was: €276.00.Current price is: €230.00.

50ug 17% OFF + 230 loyalty points
Gln18–Ser528
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse SIGLEC10/SLG2 Protein, N-His

Product name ARO-P11072-100
Uniprot ID Q80ZE3
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GQMESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTT
Molecular weight 59.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln18-Ser528
Aliases /Synonyms Sialic acid-binding Ig-like lectin 10, Siglec10, Siglec-G, mSiglec-G, Siglecg, Sialic acid-binding Ig-like lectin G, Siglec-10
Reference ARO-P11072
Note For research use only.
Molecular Constructor
Gln18–Ser528
Product name ARO-P11072-1MG
Uniprot ID Q80ZE3
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GQMESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTT
Molecular weight 59.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln18-Ser528
Aliases /Synonyms Sialic acid-binding Ig-like lectin 10, Siglec10, Siglec-G, mSiglec-G, Siglecg, Sialic acid-binding Ig-like lectin G, Siglec-10
Reference ARO-P11072
Note For research use only.
Molecular Constructor
Gln18–Ser528
Product name ARO-P11072-50
Uniprot ID Q80ZE3
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GQMESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTT
Molecular weight 59.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln18-Ser528
Aliases /Synonyms Sialic acid-binding Ig-like lectin 10, Siglec10, Siglec-G, mSiglec-G, Siglecg, Sialic acid-binding Ig-like lectin G, Siglec-10
Reference ARO-P11072
Note For research use only.
Molecular Constructor
Gln18–Ser528

Introduction to Recombinant Mouse SIGLEC10/SLG2 Protein

Recombinant Mouse SIGLEC10/SLG2 Protein is a synthetic protein that is produced through genetic engineering techniques. This protein belongs to the SIGLEC (sialic acid-binding immunoglobulin-like lectin) family and is also known as sialic acid-binding Ig-like lectin 10 (SIGLEC10) or sialic acid-binding Ig-like lectin 2 (SLG2). It is commonly used as an antigen in various research studies and has shown promising results in the field of immunotherapy.

Structure of Recombinant Mouse SIGLEC10/SLG2 Protein

The recombinant mouse SIGLEC10/SLG2 protein is a glycoprotein that consists of 479 amino acids. It has a molecular weight of approximately 57 kDa and is composed of two distinct domains: an extracellular domain and a transmembrane domain. The extracellular domain contains a sialic acid-binding site and an immunoglobulin-like domain, while the transmembrane domain anchors the protein to the cell membrane.

The extracellular domain of SIGLEC10/SLG2 protein is highly glycosylated, with multiple N-linked glycosylation sites. These glycans play a crucial role in the stability and function of the protein. The sialic acid-binding site in the extracellular domain allows the protein to bind to sialic acid-containing molecules on the surface of cells. This binding is important for the recognition and interaction of the protein with other cells.

Activity of Recombinant Mouse SIGLEC10/SLG2 Protein

Recombinant Mouse SIGLEC10/SLG2 Protein has been shown to have a wide range of activities in various biological processes. One of its main functions is its role in immune regulation. The protein is expressed on the surface of immune cells, such as dendritic cells and macrophages, and plays a crucial role in the recognition and regulation of immune responses.

SIGLEC10/SLG2 protein has been found to bind to sialylated glycans on the surface of cancer cells. This binding leads to the activation of signaling pathways that promote the killing of cancer cells by immune cells. This makes the protein a potential target for cancer immunotherapy.

In addition to its role in immune regulation, SIGLEC10/SLG2 protein has also been implicated in other biological processes such as cell adhesion, cell migration, and cell signaling. It has been shown to interact with other proteins and molecules on the cell surface, thereby influencing various cellular functions.

Application of Recombinant Mouse SIGLEC10/SLG2 Protein

Recombinant Mouse SIGLEC10/SLG2 Protein has a wide range of applications in the field of research and medicine. Its ability to bind to sialylated glycans makes it a valuable tool for studying the role of these molecules in various biological processes. The protein is commonly used as an antigen in studies investigating the immune response to cancer and infectious diseases.

Furthermore, SIGLEC10/SLG2 protein has shown promising results in cancer immunotherapy. It has been found to enhance the recognition and killing of cancer cells by immune cells, making it a potential target for the development of new cancer treatments. The protein has also been studied for its potential role in the treatment of autoimmune diseases, as it has been found to regulate the immune response in these conditions.

Conclusion

In conclusion, Recombinant Mouse SIGLEC10/SLG2 Protein is a synthetic protein with a complex structure and diverse activities. Its role in immune regulation and potential applications in cancer immunotherapy make it a valuable tool for research and medicine. Further studies on this protein may lead to the development of new and effective treatments for various diseases.

Recombinant Mouse SIGLEC10/SLG2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse SIGLEC10/SLG2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products