Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CHIT1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9D7Q1
Molecular weight:
42.35 kDa

Original price was: €428.00.Current price is: €329.00.

100ug 23% OFF + 329 loyalty points
Lys23–Leu383
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CHIT1 Protein, N-His

Product name ARO-P11076-100
Uniprot ID Q9D7Q1
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KLVCYLTNWSQYRTEAVRFFPRDVDPNLCTHVIFAFAGMDNHQLSTVEHNDELLYQELNSLKTKNPKLKTLLAVGGWTFGTQKFTDMVATASNRQTFVKSALSFLRTQGFDGLDLDWEFPGGRGSPTVDKERFTALIQDLAKAFQEEAQSSGKERLLLTAAVPSDRGLVDAGYEVDKIAQSLDFINLMAYDFHSSLEKTTGHNSPLYKRQGESGAAAEQNVDAAVTLWLQKGTPASKLILGMPTYGRSFTLASSSDNGVGAPATGPGAPGPYTKDKGVLAYYEACSWKERHRIEDQKVPYAFQDNQWVSFDDVESFKAKAAYLKQKGLGGAMVWVLDLDDFKGSFCNQGPYPLIRTLRQEL
Molecular weight 42.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys23-Leu383
Aliases /Synonyms Chitinase-1, Chit1, Chitotriosidase-1
Reference ARO-P11076
Note For research use only.
Molecular Constructor
Lys23–Leu383
Product name ARO-P11076-1MG
Uniprot ID Q9D7Q1
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KLVCYLTNWSQYRTEAVRFFPRDVDPNLCTHVIFAFAGMDNHQLSTVEHNDELLYQELNSLKTKNPKLKTLLAVGGWTFGTQKFTDMVATASNRQTFVKSALSFLRTQGFDGLDLDWEFPGGRGSPTVDKERFTALIQDLAKAFQEEAQSSGKERLLLTAAVPSDRGLVDAGYEVDKIAQSLDFINLMAYDFHSSLEKTTGHNSPLYKRQGESGAAAEQNVDAAVTLWLQKGTPASKLILGMPTYGRSFTLASSSDNGVGAPATGPGAPGPYTKDKGVLAYYEACSWKERHRIEDQKVPYAFQDNQWVSFDDVESFKAKAAYLKQKGLGGAMVWVLDLDDFKGSFCNQGPYPLIRTLRQEL
Molecular weight 42.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys23-Leu383
Aliases /Synonyms Chitinase-1, Chit1, Chitotriosidase-1
Reference ARO-P11076
Note For research use only.
Molecular Constructor
Lys23–Leu383
Product name ARO-P11076-50
Uniprot ID Q9D7Q1
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KLVCYLTNWSQYRTEAVRFFPRDVDPNLCTHVIFAFAGMDNHQLSTVEHNDELLYQELNSLKTKNPKLKTLLAVGGWTFGTQKFTDMVATASNRQTFVKSALSFLRTQGFDGLDLDWEFPGGRGSPTVDKERFTALIQDLAKAFQEEAQSSGKERLLLTAAVPSDRGLVDAGYEVDKIAQSLDFINLMAYDFHSSLEKTTGHNSPLYKRQGESGAAAEQNVDAAVTLWLQKGTPASKLILGMPTYGRSFTLASSSDNGVGAPATGPGAPGPYTKDKGVLAYYEACSWKERHRIEDQKVPYAFQDNQWVSFDDVESFKAKAAYLKQKGLGGAMVWVLDLDDFKGSFCNQGPYPLIRTLRQEL
Molecular weight 42.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys23-Leu383
Aliases /Synonyms Chitinase-1, Chit1, Chitotriosidase-1
Reference ARO-P11076
Note For research use only.
Molecular Constructor
Lys23–Leu383

Introduction to Recombinant Mouse CHIT1 Protein

Recombinant Mouse CHIT1 Protein, also known as chitotriosidase 1, is a glycosyl hydrolase enzyme that is involved in the breakdown of chitin, a major component of fungal cell walls. This protein is encoded by the CHIT1 gene and is highly conserved among mammals, with a 98% similarity to its human counterpart.

Structure of Recombinant Mouse CHIT1 Protein

The recombinant mouse CHIT1 protein is composed of 456 amino acids and has a molecular weight of approximately 50 kDa. It is a member of the chitinase family of enzymes and contains a conserved catalytic domain that is responsible for its enzymatic activity.

The crystal structure of the recombinant mouse CHIT1 protein has been determined, revealing a three-dimensional structure with a central beta-barrel surrounded by alpha-helices. This structure is similar to other chitinases and is essential for its enzymatic function.

Activity of Recombinant Mouse CHIT1 Protein

The main function of recombinant mouse CHIT1 protein is the hydrolysis of chitin, which is found in the cell walls of fungi, insects, and crustaceans. It cleaves the beta-1,4-glycosidic bond between N-acetylglucosamine residues, releasing chitobiose as a product.

Studies have shown that recombinant mouse CHIT1 protein has a higher activity towards chitin compared to other chitinases, making it a valuable tool for chitin degradation in various applications. It has also been found to have antifungal activity, inhibiting the growth of fungi by breaking down their cell walls.

In addition to its chitinase activity, recombinant mouse CHIT1 protein has been shown to have immunomodulatory effects. It can stimulate the production of pro-inflammatory cytokines and chemokines, as well as enhance the phagocytic activity of macrophages. This makes it a potential therapeutic target for immune-related diseases.

Application of Recombinant Mouse CHIT1 Protein

Recombinant mouse CHIT1 protein has a wide range of applications in both research and industrial settings. Its chitinase activity makes it a valuable tool for the degradation of chitin in various industries, such as food, agriculture, and waste management.

In the research field, recombinant mouse CHIT1 protein is used to study the role of chitinases in various biological processes, such as fungal infections, immune responses, and insect development. It is also used in the production of chitobiose, which has potential applications in the pharmaceutical industry as a prebiotic and drug delivery agent.

Furthermore, recombinant mouse CHIT1 protein has been investigated as a potential therapeutic agent for diseases such as asthma, inflammatory bowel disease, and cancer. Its immunomodulatory effects and ability to degrade chitin make it a promising candidate for the treatment of these conditions.

Conclusion

In summary, recombinant mouse CHIT1 protein is a versatile enzyme with a wide range of applications. Its structure, activity, and potential therapeutic properties make it a valuable tool in both research and industrial settings. Further studies on this protein will provide a better understanding of its role in various biological processes and may pave the way for new therapeutic interventions.

Recombinant Mouse CHIT1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CHIT1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products