Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD226/DNAM-1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q8K4F0
Molecular weight:
28.20 kDa

Original price was: €267.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
Thr26–Pro254
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD226/DNAM-1 Protein, N-His

Product name ARO-P11075-100
Uniprot ID Q8K4F0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILP
Molecular weight 28.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr26-Pro254
Aliases /Synonyms CD226 antigen, Platelet and T-cell activation antigen 1, Pta1, CD226, Cd226
Reference ARO-P11075
Note For research use only.
Molecular Constructor
Thr26–Pro254
Product name ARO-P11075-1MG
Uniprot ID Q8K4F0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILP
Molecular weight 28.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr26-Pro254
Aliases /Synonyms CD226 antigen, Platelet and T-cell activation antigen 1, Pta1, CD226, Cd226
Reference ARO-P11075
Note For research use only.
Molecular Constructor
Thr26–Pro254
Product name ARO-P11075-50
Uniprot ID Q8K4F0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILP
Molecular weight 28.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr26-Pro254
Aliases /Synonyms CD226 antigen, Platelet and T-cell activation antigen 1, Pta1, CD226, Cd226
Reference ARO-P11075
Note For research use only.
Molecular Constructor
Thr26–Pro254

Introduction

Recombinant Mouse CD226/DNAM-1 Protein is a genetically engineered protein that is derived from the mouse CD226 gene. This protein plays a crucial role in immune response and is involved in the regulation of T cell activation and cytotoxicity. In this article, we will discuss the structure, activity and applications of this recombinant protein.

Structure of Recombinant Mouse CD226/DNAM-1 Protein

The recombinant mouse CD226/DNAM-1 protein is a type I transmembrane glycoprotein that belongs to the immunoglobulin superfamily. It is composed of a single extracellular domain, a transmembrane domain and a cytoplasmic tail. The extracellular domain consists of two immunoglobulin-like domains, an N-terminal V-type domain and a C-terminal C2-type domain. These domains are responsible for binding to ligands and interacting with other proteins.

Activity of Recombinant Mouse CD226/DNAM-1 Protein

The main function of CD226/DNAM-1 protein is to regulate T cell activation and cytotoxicity. It acts as a co-stimulatory molecule on T cells and enhances their response to antigen stimulation. This protein also plays a crucial role in the activation of natural killer (NK) cells and promotes their cytotoxicity against target cells.

CD226/DNAM-1 protein has been shown to interact with multiple ligands, including CD155, CD112, and CD96. These interactions lead to the activation of downstream signaling pathways, such as the PI3K/AKT and MAPK pathways, which are involved in T cell and NK cell activation.

In addition to its role in immune response, CD226/DNAM-1 protein has also been implicated in the regulation of tumor growth and metastasis. It has been shown to promote the killing of tumor cells by NK cells and T cells, and its expression is often downregulated in various types of cancer.

Applications of Recombinant Mouse CD226/DNAM-1 Protein

Recombinant Mouse CD226/DNAM-1 Protein has a wide range of applications in both research and clinical settings. Here are some of the major applications of this protein:

1. Immunotherapy

CD226/DNAM-1 protein has been identified as a potential target for cancer immunotherapy. By enhancing the activity of NK cells and T cells, this protein can help in the elimination of tumor cells. Recombinant CD226/DNAM-1 protein can be used in combination with other immunotherapeutic agents to enhance their efficacy.

2. Vaccine development

The ability of CD226/DNAM-1 protein to enhance T cell response makes it a potential candidate for vaccine development. Recombinant CD226/DNAM-1 protein can be used as an adjuvant to boost the immune response to vaccines.

3. Biomarker for cancer diagnosis and prognosis

The expression of CD226/DNAM-1 protein has been found to be altered in various types of cancer. As a result, it can serve as a potential biomarker for cancer diagnosis and prognosis. Recombinant CD226/DNAM-1 protein can be used in diagnostic tests to detect the levels of this protein in patient samples.

4. Drug target for autoimmune diseases

CD226/DNAM-1 protein has been implicated in the pathogenesis of several autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis. Recombinant CD226/DNAM-1 protein can be used in drug discovery and development to identify potential inhibitors or modulators of this protein for the treatment of autoimmune diseases.

Conclusion

In summary, Recombinant Mouse CD226/DNAM-1 Protein is a crucial protein involved in immune response and has various applications in research and clinical settings. Its structure, activity and applications make it a promising target for cancer immunotherapy, vaccine development, and as a biomarker for

Recombinant Mouse CD226/DNAM-1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD226/DNAM-1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products