Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse METRNL/Subfatin Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q8VE43
Molecular weight:
29.85 kDa

Original price was: €216.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Glu67–Glu311
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse METRNL/Subfatin Protein, N-His

Product name ARO-P11548-100
Uniprot ID Q8VE43
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EVEQVYLRCSAGSVEWMYPTGALIVNLRPNTFSPAQNLTVCIKPFRDSSGANIYLEKTGELRLLVRDIRGEPGQVQCFSLEQGGLFVEATPQQDISRRTTGFQYELMSGQRGLDLHVLSAPCRPCSDTEVLLAICTSDFVVRGFIEDVTHVPEQQVSVIYLRVNRLHRQKSRVFQPAPEDSGHWLGHVTTLLQCGVRPGHGEFLFTGHVHFGEAQLGCAPRFSDFQRMYRKAEEMGINPCEINME
Molecular weight 29.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu67-Glu311
Aliases /Synonyms Meteorin-like protein, Subfatin, Metrnl
Reference ARO-P11548
Note For research use only.
Molecular Constructor
Glu67–Glu311
Product name ARO-P11548-1MG
Uniprot ID Q8VE43
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EVEQVYLRCSAGSVEWMYPTGALIVNLRPNTFSPAQNLTVCIKPFRDSSGANIYLEKTGELRLLVRDIRGEPGQVQCFSLEQGGLFVEATPQQDISRRTTGFQYELMSGQRGLDLHVLSAPCRPCSDTEVLLAICTSDFVVRGFIEDVTHVPEQQVSVIYLRVNRLHRQKSRVFQPAPEDSGHWLGHVTTLLQCGVRPGHGEFLFTGHVHFGEAQLGCAPRFSDFQRMYRKAEEMGINPCEINME
Molecular weight 29.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu67-Glu311
Aliases /Synonyms Meteorin-like protein, Subfatin, Metrnl
Reference ARO-P11548
Note For research use only.
Molecular Constructor
Glu67–Glu311
Product name ARO-P11548-50
Uniprot ID Q8VE43
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EVEQVYLRCSAGSVEWMYPTGALIVNLRPNTFSPAQNLTVCIKPFRDSSGANIYLEKTGELRLLVRDIRGEPGQVQCFSLEQGGLFVEATPQQDISRRTTGFQYELMSGQRGLDLHVLSAPCRPCSDTEVLLAICTSDFVVRGFIEDVTHVPEQQVSVIYLRVNRLHRQKSRVFQPAPEDSGHWLGHVTTLLQCGVRPGHGEFLFTGHVHFGEAQLGCAPRFSDFQRMYRKAEEMGINPCEINME
Molecular weight 29.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu67-Glu311
Aliases /Synonyms Meteorin-like protein, Subfatin, Metrnl
Reference ARO-P11548
Note For research use only.
Molecular Constructor
Glu67–Glu311

Introduction

Recombinant Mouse METRNL/Subfatin Protein is a novel protein that has recently gained attention in the scientific community for its potential therapeutic applications. This protein is a member of the Meteorin-like (METRNL) family, which is a group of secreted proteins that play important roles in various physiological processes. In this article, we will explore the structure, activity, and potential applications of Recombinant Mouse METRNL/Subfatin Protein.

Structure of Recombinant Mouse METRNL/Subfatin Protein

Recombinant Mouse METRNL/Subfatin Protein is a 40 kDa protein that is composed of 345 amino acids. It is a secreted protein, meaning it is released from cells and can travel to different parts of the body. The protein contains a conserved N-terminal domain and a C-terminal domain that is unique to the METRNL family. The N-terminal domain is responsible for the protein’s secretion, while the C-terminal domain is important for its biological activity.

Activity of Recombinant Mouse METRNL/Subfatin Protein

Recombinant Mouse METRNL/Subfatin Protein has been shown to have multiple biological activities. One of its main functions is its role in regulating energy metabolism. Studies have shown that this protein can increase energy expenditure and improve insulin sensitivity, making it a potential therapeutic target for obesity and type 2 diabetes.

In addition, Recombinant Mouse METRNL/Subfatin Protein has been found to have anti-inflammatory properties. It can inhibit the production of pro-inflammatory cytokines and promote the production of anti-inflammatory cytokines, making it a potential treatment for inflammatory diseases.

Furthermore, this protein has been shown to have neuroprotective effects. It can promote the survival and differentiation of neurons, making it a potential therapy for neurodegenerative diseases.

Application of Recombinant Mouse METRNL/Subfatin Protein

The potential applications of Recombinant Mouse METRNL/Subfatin Protein are vast and diverse. Due to its role in regulating energy metabolism, this protein has been studied as a potential treatment for obesity and type 2 diabetes. In animal studies, administration of this protein has been shown to reduce body weight and improve glucose tolerance. Clinical trials are currently underway to further investigate its potential as a therapeutic for these conditions.

In addition, the anti-inflammatory properties of Recombinant Mouse METRNL/Subfatin Protein make it a promising candidate for the treatment of inflammatory diseases such as rheumatoid arthritis, multiple sclerosis, and inflammatory bowel disease. Animal studies have shown that this protein can reduce inflammation and improve disease symptoms.

Moreover, the neuroprotective effects of this protein make it a potential therapy for neurodegenerative diseases such as Alzheimer’s and Parkinson’s. Studies have shown that Recombinant Mouse METRNL/Subfatin Protein can protect neurons from damage and promote their survival and differentiation.

Conclusion

Recombinant Mouse METRNL/Subfatin Protein is a novel protein with diverse biological activities and potential therapeutic applications. Its structure, with a conserved N-terminal domain and a unique C-terminal domain, allows for its secretion and biological activity. Its role in regulating energy metabolism, anti-inflammatory properties, and neuroprotective effects make it a promising candidate for the treatment of obesity, type 2 diabetes, inflammatory diseases, and neurodegenerative diseases. Further research and clinical trials are needed to fully understand the potential of this protein and its applications in human health.

Recombinant Mouse METRNL/Subfatin Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse METRNL/Subfatin Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products