Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse IgA1/IGHA1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P01878
Molecular weight:
13.87 kDa

Original price was: €365.00.Current price is: €329.00.

100ug 10% OFF + 329 loyalty points
Pro219–Asp321
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse IgA1/IGHA1 Protein, N-His

Product name ARO-P10617-100
Uniprot ID P01878
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence PQVHLLPPPSEELALNELLSLTCLVRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGATTYLVTSVLRVSAETWKQGDQYSCMVGHEALPMNFTQKTID
Molecular weight 13.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro219-Asp321
Aliases /Synonyms Immunoglobulin heavy constant alpha 1, Ig alpha-1 chain C region, Ig alpha-1 chain C region TRO, Ig alpha-1 chain C region BUR, IGHA1
Reference ARO-P10617
Note For research use only.
Molecular Constructor
Pro219–Asp321
Product name ARO-P10617-1MG
Uniprot ID P01878
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence PQVHLLPPPSEELALNELLSLTCLVRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGATTYLVTSVLRVSAETWKQGDQYSCMVGHEALPMNFTQKTID
Molecular weight 13.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro219-Asp321
Aliases /Synonyms Immunoglobulin heavy constant alpha 1, Ig alpha-1 chain C region, Ig alpha-1 chain C region TRO, Ig alpha-1 chain C region BUR, IGHA1
Reference ARO-P10617
Note For research use only.
Molecular Constructor
Pro219–Asp321
Product name ARO-P10617-50
Uniprot ID P01878
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence PQVHLLPPPSEELALNELLSLTCLVRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGATTYLVTSVLRVSAETWKQGDQYSCMVGHEALPMNFTQKTID
Molecular weight 13.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro219-Asp321
Aliases /Synonyms Immunoglobulin heavy constant alpha 1, Ig alpha-1 chain C region, Ig alpha-1 chain C region TRO, Ig alpha-1 chain C region BUR, IGHA1
Reference ARO-P10617
Note For research use only.
Molecular Constructor
Pro219–Asp321

Introduction:
Recombinant proteins have revolutionized the field of biotechnology and have become an essential tool in various scientific applications. Recombinant Mouse IgA1/IGHA1 protein is one such recombinant protein that has gained significant attention due to its unique structure and diverse functions. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse IgA1/IGHA1 protein.

Structure of Recombinant Mouse IgA1/IGHA1 Protein:
Recombinant Mouse IgA1/IGHA1 protein is a member of the immunoglobulin superfamily and is composed of two heavy chains and two light chains. The heavy chains are further divided into constant (C) and variable (V) regions, while the light chains consist of only one constant region. The C region of the heavy chain is responsible for the effector functions of the protein, whereas the V region is responsible for antigen recognition. The constant region of the light chain also contributes to antigen binding. The heavy and light chains are linked together by disulfide bonds, forming a Y-shaped structure.

Activity of Recombinant Mouse IgA1/IGHA1 Protein:
Recombinant Mouse IgA1/IGHA1 protein is an antibody that plays a crucial role in the immune system. It is the second most abundant antibody in the mucosal immune system, after IgA2. IgA1 antibodies are mainly found in the mucosal secretions of the respiratory, gastrointestinal, and genitourinary tracts. They act as the first line of defense against invading pathogens by neutralizing them and preventing their attachment to mucosal surfaces. IgA1 antibodies also have anti-inflammatory properties and can regulate the immune response.

Recombinant Mouse IgA1/IGHA1 protein is produced by B cells in response to an antigen. The antigen is recognized by the variable region of the heavy and light chains, leading to the activation of B cells and subsequent production of IgA1 antibodies. These antibodies can then bind to the antigen and initiate the immune response.

Applications of Recombinant Mouse IgA1/IGHA1 Protein:
Recombinant Mouse IgA1/IGHA1 protein has a wide range of applications in the field of biotechnology and medicine. Some of the major applications are discussed below:

1. Diagnostic tool:
Recombinant Mouse IgA1/IGHA1 protein can be used as a diagnostic tool to detect the presence of specific antigens in biological samples. The antibody’s ability to bind to antigens with high specificity makes it a valuable tool in various diagnostic tests, such as ELISA and Western blot.

2. Therapeutic agent:
Recombinant Mouse IgA1/IGHA1 protein has been used as a therapeutic agent in the treatment of various diseases, including autoimmune disorders and cancer. The antibody’s anti-inflammatory properties make it a potential candidate for the treatment of inflammatory diseases, such as rheumatoid arthritis and inflammatory bowel disease. It has also been shown to have anti-tumor activity, making it a promising candidate for cancer immunotherapy.

3. Vaccine adjuvant:
Recombinant Mouse IgA1/IGHA1 protein can also act as a vaccine adjuvant, enhancing the immune response to a particular antigen. It can increase the production of antigen-specific IgA1 antibodies, leading to a more robust and long-lasting immune response.

4. Research tool:
Recombinant Mouse IgA1/IGHA1 protein is widely used as a research tool in various studies related to the immune system. It can be used to study the mechanisms of antibody production, immune response, and antigen-antibody interactions.

Conclusion:
Recombinant Mouse IgA1/IGHA1 protein is a versatile and essential protein in the field of biotechnology and medicine. Its unique structure and diverse functions make it a valuable tool for various scientific applications. From diagnostics to therapeutics, this protein has a wide range of applications and continues to be an active area of research. With further advancements in recombinant protein technology, the potential of Recombinant Mouse IgA1/IGHA1 protein in various

Recombinant Mouse IgA1/IGHA1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse IgA1/IGHA1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products