Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse ASGR1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P34927
Molecular weight:
17.52 kDa

Original price was: €269.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
Asn156–Asn284
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse ASGR1 Protein, N-His

Product name ARO-P10589-100
Uniprot ID P34927
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN
Molecular weight 17.52 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn156-Asn284
Aliases /Synonyms HL-1, ASGP-R 1, Asialoglycoprotein receptor 1, CLEC4H1, ASGR1, C-type lectin domain family 4 member H1, ASGPR 1, Hepatic lectin H1
Reference ARO-P10589
Note For research use only.
Molecular Constructor
Asn156–Asn284
Product name ARO-P10589-1MG
Uniprot ID P34927
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN
Molecular weight 17.52 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn156-Asn284
Aliases /Synonyms HL-1, ASGP-R 1, Asialoglycoprotein receptor 1, CLEC4H1, ASGR1, C-type lectin domain family 4 member H1, ASGPR 1, Hepatic lectin H1
Reference ARO-P10589
Note For research use only.
Molecular Constructor
Asn156–Asn284
Product name ARO-P10589-50
Uniprot ID P34927
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN
Molecular weight 17.52 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn156-Asn284
Aliases /Synonyms HL-1, ASGP-R 1, Asialoglycoprotein receptor 1, CLEC4H1, ASGR1, C-type lectin domain family 4 member H1, ASGPR 1, Hepatic lectin H1
Reference ARO-P10589
Note For research use only.
Molecular Constructor
Asn156–Asn284

Introduction to Recombinant Mouse ASGR1 Protein

Recombinant Mouse ASGR1 Protein is a highly versatile and valuable protein that has been widely used in various scientific research and biotechnological applications. This protein is a recombinant form of the mouse asialoglycoprotein receptor 1 (ASGR1), which is a cell surface receptor found in liver cells. ASGR1 plays a crucial role in the recognition and clearance of glycoproteins from the circulation, making it an important component of the body’s immune system. In this article, we will explore the structure, activity, and applications of Recombinant Mouse ASGR1 Protein.

Structure of Recombinant Mouse ASGR1 Protein

The recombinant form of ASGR1 is a glycoprotein that is composed of two subunits, α and β, with a total molecular weight of approximately 140 kDa. The α subunit is responsible for ligand binding, while the β subunit is involved in signal transduction. The two subunits are linked by disulfide bonds and form a heterodimeric structure that is essential for the protein’s activity.

The α subunit of ASGR1 contains a carbohydrate recognition domain (CRD) that is responsible for binding to glycoproteins. This domain is highly conserved among different species, making Recombinant Mouse ASGR1 Protein a useful tool for studying the interactions between glycoproteins and cell surface receptors. The β subunit, on the other hand, contains a transmembrane domain and a cytoplasmic tail that is involved in signal transduction.

Activity of Recombinant Mouse ASGR1 Protein

Recombinant Mouse ASGR1 Protein has a high affinity for binding to glycoproteins, particularly those with terminal galactose or N-acetylgalactosamine residues. This binding triggers a series of events that lead to the internalization and degradation of the glycoprotein, ultimately clearing it from the circulation. This activity is crucial for maintaining the body’s immune system and preventing the accumulation of unwanted glycoproteins in the liver.

Moreover, Recombinant Mouse ASGR1 Protein has been shown to be involved in other cellular processes, such as cell adhesion, migration, and proliferation. It has also been found to play a role in the regulation of glucose metabolism and insulin signaling. These additional activities make Recombinant Mouse ASGR1 Protein a promising target for therapeutic interventions in various diseases.

Applications of Recombinant Mouse ASGR1 Protein

Recombinant Mouse ASGR1 Protein has been widely used in various scientific research and biotechnological applications. Its high affinity for binding to glycoproteins makes it a valuable tool for studying the interactions between glycoproteins and cell surface receptors. This has led to a better understanding of the role of ASGR1 in the immune system and its potential as a therapeutic target.

Furthermore, Recombinant Mouse ASGR1 Protein has been used in the development of drug delivery systems, particularly for targeting drugs to the liver. Its ability to specifically bind to glycoproteins on liver cells makes it an ideal candidate for delivering drugs to this organ. This has potential applications in the treatment of liver diseases, such as hepatitis and liver cancer.

In addition, Recombinant Mouse ASGR1 Protein has been used in the development of diagnostic assays for various diseases. Its high specificity for binding to glycoproteins allows for the detection and quantification of these molecules in biological samples, making it a valuable tool for disease diagnosis and monitoring.

Conclusion

Recombinant Mouse ASGR1 Protein is a versatile and valuable protein that has a wide range of applications in scientific research and biotechnology. Its unique structure and high affinity for binding to glycoproteins make it a useful tool for studying the interactions between glycoproteins and cell surface receptors.

Recombinant Mouse ASGR1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse ASGR1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products