Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse FRZB Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P97401
Molecular weight:
12.87 kDa

Original price was: €418.00.Current price is: €329.00.

100ug 21% OFF + 329 loyalty points
Thr186–Lys277
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse FRZB Protein, N-His

Product name ARO-P11097-100
Uniprot ID P97401
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TQKTYFRNNYNYVIRAKVKEVKMKCHDVTAVVEVKEILKASLVNIPRDTVNLYTTSGCLCPPLTVNEEYVIMGYEDEERSRLLLVEGSIAEK
Molecular weight 12.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr186-Lys277
Aliases /Synonyms Frzb, Frezzled, sFRP-3, Fre, Frzb1, Secreted frizzled-related protein 3, Frizzled-related protein 1, Sfrp3, Fiz, Fritz, FrzB-1
Reference ARO-P11097
Note For research use only.
Molecular Constructor
Thr186–Lys277
Product name ARO-P11097-1MG
Uniprot ID P97401
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TQKTYFRNNYNYVIRAKVKEVKMKCHDVTAVVEVKEILKASLVNIPRDTVNLYTTSGCLCPPLTVNEEYVIMGYEDEERSRLLLVEGSIAEK
Molecular weight 12.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr186-Lys277
Aliases /Synonyms Frzb, Frezzled, sFRP-3, Fre, Frzb1, Secreted frizzled-related protein 3, Frizzled-related protein 1, Sfrp3, Fiz, Fritz, FrzB-1
Reference ARO-P11097
Note For research use only.
Molecular Constructor
Thr186–Lys277
Product name ARO-P11097-50
Uniprot ID P97401
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TQKTYFRNNYNYVIRAKVKEVKMKCHDVTAVVEVKEILKASLVNIPRDTVNLYTTSGCLCPPLTVNEEYVIMGYEDEERSRLLLVEGSIAEK
Molecular weight 12.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr186-Lys277
Aliases /Synonyms Frzb, Frezzled, sFRP-3, Fre, Frzb1, Secreted frizzled-related protein 3, Frizzled-related protein 1, Sfrp3, Fiz, Fritz, FrzB-1
Reference ARO-P11097
Note For research use only.
Molecular Constructor
Thr186–Lys277

Introduction

Recombinant Mouse FRZB Protein, also known as Frizzled-related protein, is a secreted protein that belongs to the Frizzled family of Wnt signaling regulators. It is encoded by the Fzrb gene and is highly conserved among different species, including mice and humans. Recombinant Mouse FRZB Protein has been extensively studied for its role in regulating Wnt signaling and its potential applications in various biological processes. In this article, we will discuss the structure, activity, and applications of this protein.

Structure of Recombinant Mouse FRZB Protein

Recombinant Mouse FRZB Protein is a 32 kDa protein with a conserved structure among different species. It consists of a signal peptide, a cysteine-rich domain (CRD), and a C-terminal domain. The CRD is highly conserved and is responsible for binding to Wnt ligands. The C-terminal domain, on the other hand, is responsible for the interaction with other proteins and plays a crucial role in the regulation of Wnt signaling.

Activity of Recombinant Mouse FRZB Protein

Recombinant Mouse FRZB Protein is a potent inhibitor of the Wnt signaling pathway. It binds to Wnt ligands and prevents their interaction with Frizzled receptors, thereby blocking the downstream signaling cascade. This inhibition of Wnt signaling is essential for the proper development and maintenance of various tissues and organs. Studies have also shown that Recombinant Mouse FRZB Protein can modulate the activity of other signaling pathways, such as the TGF-β and BMP pathways, further highlighting its role as a crucial regulator of cellular processes.

Applications of Recombinant Mouse FRZB Protein

Recombinant Mouse FRZB Protein has a wide range of potential applications in various biological processes. Its ability to inhibit Wnt signaling makes it a promising candidate for the treatment of Wnt-related diseases, such as cancer and osteoporosis. In cancer, dysregulated Wnt signaling is often observed, leading to uncontrolled cell growth and proliferation. Recombinant Mouse FRZB Protein can potentially block this pathway and inhibit cancer growth. In osteoporosis, Wnt signaling plays a crucial role in bone formation and maintenance. Recombinant Mouse FRZB Protein can modulate this pathway and promote bone formation, making it a potential therapeutic agent for the treatment of osteoporosis.

Moreover, Recombinant Mouse FRZB Protein has also been studied for its role in embryonic development and tissue regeneration. During embryogenesis, Wnt signaling is essential for proper patterning and differentiation of various tissues and organs. Recombinant Mouse FRZB Protein can modulate this pathway and potentially regulate tissue development. In tissue regeneration, Wnt signaling is crucial for the repair and regeneration of damaged tissues. Recombinant Mouse FRZB Protein can potentially enhance this process by modulating Wnt signaling and promoting tissue repair.

Conclusion

In summary, Recombinant Mouse FRZB Protein is a highly conserved protein that plays a crucial role in regulating Wnt signaling. Its structure, activity, and potential applications make it a promising candidate for the treatment of various diseases and for promoting tissue regeneration. Further studies on this protein may lead to the development of novel therapeutics for Wnt-related diseases and tissue regeneration.

Recombinant Mouse FRZB Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse FRZB Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products