Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CXCL17/DMC/VCC1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q5UW37
Molecular weight:
22.20 kDa

Original price was: €288.00.Current price is: €230.00.

50ug 20% OFF + 230 loyalty points
His36–Leu119
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CXCL17/DMC/VCC1 Protein, N-His-SUMO

Product name ARO-P10540-100
Uniprot ID Q5UW37
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HLAPRRWLLEGGQECECKDWFLQAPKRKATAVLGPPRKQCPCDHVKGREKKNRHQKHHRKSQRPSRACQQFLKRCHLASFALPL
Molecular weight 22.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His36-Leu119
Aliases /Synonyms C-X-C motif chemokine 17, VEGF coregulated chemokine 1, 6-Cys CXCL17, VCC1, DMC, Dendritic cell and monocyte chemokine-like protein, CXCL17
Reference ARO-P10540
Note For research use only.
Molecular Constructor
His36–Leu119
Product name ARO-P10540-1MG
Uniprot ID Q5UW37
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HLAPRRWLLEGGQECECKDWFLQAPKRKATAVLGPPRKQCPCDHVKGREKKNRHQKHHRKSQRPSRACQQFLKRCHLASFALPL
Molecular weight 22.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His36-Leu119
Aliases /Synonyms C-X-C motif chemokine 17, VEGF coregulated chemokine 1, 6-Cys CXCL17, VCC1, DMC, Dendritic cell and monocyte chemokine-like protein, CXCL17
Reference ARO-P10540
Note For research use only.
Molecular Constructor
His36–Leu119
Product name ARO-P10540-50
Uniprot ID Q5UW37
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HLAPRRWLLEGGQECECKDWFLQAPKRKATAVLGPPRKQCPCDHVKGREKKNRHQKHHRKSQRPSRACQQFLKRCHLASFALPL
Molecular weight 22.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His36-Leu119
Aliases /Synonyms C-X-C motif chemokine 17, VEGF coregulated chemokine 1, 6-Cys CXCL17, VCC1, DMC, Dendritic cell and monocyte chemokine-like protein, CXCL17
Reference ARO-P10540
Note For research use only.
Molecular Constructor
His36–Leu119

Recombinant Mouse CXCL17/DMC/VCC1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse CXCL17/DMC/VCC1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products