Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD147/BSG Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P18572
Molecular weight:
35.60 kDa

Original price was: €262.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Ala22–Arg325
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD147/BSG Protein, N-His

Product name ARO-P10957-100
Uniprot ID P18572
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSR
Molecular weight 35.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala22-Arg325
Aliases /Synonyms Basic immunoglobulin superfamily, Membrane glycoprotein gp42, HT7 antigen, Basigin, Bsg, CD147
Reference ARO-P10957
Note For research use only.
Molecular Constructor
Ala22–Arg325
Product name ARO-P10957-1MG
Uniprot ID P18572
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSR
Molecular weight 35.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala22-Arg325
Aliases /Synonyms Basic immunoglobulin superfamily, Membrane glycoprotein gp42, HT7 antigen, Basigin, Bsg, CD147
Reference ARO-P10957
Note For research use only.
Molecular Constructor
Ala22–Arg325
Product name ARO-P10957-50
Uniprot ID P18572
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSR
Molecular weight 35.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala22-Arg325
Aliases /Synonyms Basic immunoglobulin superfamily, Membrane glycoprotein gp42, HT7 antigen, Basigin, Bsg, CD147
Reference ARO-P10957
Note For research use only.
Molecular Constructor
Ala22–Arg325

Introduction

Recombinant Mouse CD147/BSG Protein, also known as Basigin or EMMPRIN, is a transmembrane glycoprotein that plays a crucial role in various physiological and pathological processes. It is encoded by the BSG gene and is expressed in a wide range of tissues, including the brain, heart, liver, and immune cells. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse CD147/BSG Protein.

Structure of Recombinant Mouse CD147/BSG Protein

Recombinant Mouse CD147/BSG Protein is a type I transmembrane protein with a molecular weight of approximately 40 kDa. It consists of a large extracellular domain, a transmembrane domain, and a short cytoplasmic tail. The extracellular domain contains two immunoglobulin-like domains, which are responsible for the protein’s interaction with other molecules. The transmembrane domain anchors the protein to the cell membrane, while the cytoplasmic tail is involved in signaling and protein-protein interactions.

Activity of Recombinant Mouse CD147/BSG Protein

Recombinant Mouse CD147/BSG Protein has multiple functions and is involved in various physiological and pathological processes. It acts as a receptor for the extracellular matrix metalloproteinase inducer (EMMPRIN), which plays a crucial role in tumor invasion and metastasis. The binding of EMMPRIN to CD147 stimulates the production of matrix metalloproteinases (MMPs), which are enzymes that degrade the extracellular matrix and promote tumor cell migration.

Furthermore, Recombinant Mouse CD147/BSG Protein is also involved in immune regulation. It is expressed on the surface of T cells and interacts with CD98, a protein that is essential for T cell activation and proliferation. CD147 also plays a role in the regulation of the immune response by promoting the production of pro-inflammatory cytokines and chemokines.

In addition to its role in tumor progression and immune regulation, Recombinant Mouse CD147/BSG Protein is also involved in angiogenesis, the process of forming new blood vessels. It interacts with vascular endothelial growth factor (VEGF) and promotes the migration and proliferation of endothelial cells, which are essential for the growth of new blood vessels.

Applications of Recombinant Mouse CD147/BSG Protein

Recombinant Mouse CD147/BSG Protein has a wide range of applications in both research and clinical settings. Its involvement in tumor progression and immune regulation makes it a potential target for cancer therapy. In fact, several studies have shown that targeting CD147 can inhibit tumor growth and metastasis in various cancer types.

Furthermore, Recombinant Mouse CD147/BSG Protein is also used in research as a tool to study various physiological and pathological processes. It is commonly used in cell culture experiments to investigate its role in tumor invasion, immune regulation, and angiogenesis. In addition, CD147 is also used as a biomarker for certain diseases, including cancer and inflammatory disorders.

Moreover, Recombinant Mouse CD147/BSG Protein has potential applications in drug delivery. As it is highly expressed on the surface of tumor cells, it can be targeted for drug delivery to specifically target cancer cells while sparing healthy cells. This can improve the efficacy and reduce the side effects of cancer treatment.

Conclusion

In summary, Recombinant Mouse CD147/BSG Protein is a multifunctional protein that plays a crucial role in tumor progression, immune regulation, and angiogenesis. Its structure, activity, and applications make it a valuable tool for both research and clinical purposes. Further studies on the role of CD147 in various diseases may lead to the development of novel therapies and diagnostic tools.

Recombinant Mouse CD147/BSG Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD147/BSG Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products