Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse GDF7 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P43029
Molecular weight:
22.12 kDa

Original price was: €251.00.Current price is: €193.00.

50ug 23% OFF + 193 loyalty points
His86–Thr270
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse GDF7 Protein, N-His

Product name ARO-P10584-100
Uniprot ID P43029
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HFMMSLYRSLAGRAPVAAASGHGRVDTITGFTDQATQDETAAAEPGQSFLFDVSSLSEADEVVNAELRVLRRRSPEPDRDSATLLPRLLLSTCPDEAGTAHLLHSRAAEPLGGARWEAFDVTDAVQSHRRWPRASRKFCLVLRAVTASESSPLALRRLGFGWPGGGDGGGTAAEERALLVISSRT
Molecular weight 22.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His86-Thr270
Aliases /Synonyms Growth/differentiation factor 7, GDF-7, GDF7
Reference ARO-P10584
Note For research use only.
Molecular Constructor
His86–Thr270
Product name ARO-P10584-1MG
Uniprot ID P43029
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HFMMSLYRSLAGRAPVAAASGHGRVDTITGFTDQATQDETAAAEPGQSFLFDVSSLSEADEVVNAELRVLRRRSPEPDRDSATLLPRLLLSTCPDEAGTAHLLHSRAAEPLGGARWEAFDVTDAVQSHRRWPRASRKFCLVLRAVTASESSPLALRRLGFGWPGGGDGGGTAAEERALLVISSRT
Molecular weight 22.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His86-Thr270
Aliases /Synonyms Growth/differentiation factor 7, GDF-7, GDF7
Reference ARO-P10584
Note For research use only.
Molecular Constructor
His86–Thr270
Product name ARO-P10584-50
Uniprot ID P43029
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HFMMSLYRSLAGRAPVAAASGHGRVDTITGFTDQATQDETAAAEPGQSFLFDVSSLSEADEVVNAELRVLRRRSPEPDRDSATLLPRLLLSTCPDEAGTAHLLHSRAAEPLGGARWEAFDVTDAVQSHRRWPRASRKFCLVLRAVTASESSPLALRRLGFGWPGGGDGGGTAAEERALLVISSRT
Molecular weight 22.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His86-Thr270
Aliases /Synonyms Growth/differentiation factor 7, GDF-7, GDF7
Reference ARO-P10584
Note For research use only.
Molecular Constructor
His86–Thr270

Introduction to Recombinant Mouse GDF7 Protein

Recombinant Mouse GDF7 Protein, also known as Growth Differentiation Factor 7, is a member of the transforming growth factor-beta (TGF-β) superfamily. It is a secreted protein that plays a critical role in embryonic development, tissue repair, and maintenance of adult tissues. This protein is produced through recombinant DNA technology, making it a valuable tool for scientific research and potential therapeutic applications.

Structure of Recombinant Mouse GDF7 Protein

Recombinant Mouse GDF7 Protein is a homodimer, meaning it is composed of two identical subunits. Each subunit consists of a 120 amino acid chain, with a molecular weight of approximately 13 kDa. The protein has a highly conserved cysteine-rich domain, which is essential for its biological activity. This domain allows the protein to form disulfide bonds, which are crucial for its structural stability.

Activity of Recombinant Mouse GDF7 Protein

Recombinant Mouse GDF7 Protein is a potent regulator of cell growth and differentiation. It exerts its effects by binding to specific cell surface receptors, known as type I and type II receptors. Upon binding, the receptors activate intracellular signaling pathways, leading to changes in gene expression and cellular responses.

One of the key functions of Recombinant Mouse GDF7 Protein is its role in skeletal development. It has been shown to promote the differentiation of mesenchymal stem cells into bone-forming cells, known as osteoblasts. This process is essential for bone growth and repair. Additionally, Recombinant Mouse GDF7 Protein has been found to regulate the formation and maintenance of cartilage, another crucial component of the skeletal system.

Apart from its role in skeletal development, Recombinant Mouse GDF7 Protein also plays a vital role in tissue repair and regeneration. It has been shown to enhance the proliferation and migration of cells involved in wound healing, such as fibroblasts and endothelial cells. This protein also promotes the production of extracellular matrix components, which are essential for tissue repair and regeneration.

Application of Recombinant Mouse GDF7 Protein

Due to its diverse biological activities, Recombinant Mouse GDF7 Protein has numerous potential applications in scientific research and medicine. One of the primary uses of this protein is in the study of skeletal development and disorders. Its ability to induce bone and cartilage formation makes it a valuable tool for investigating conditions such as osteoporosis and osteoarthritis.

Recombinant Mouse GDF7 Protein also has potential therapeutic applications. Its role in tissue repair and regeneration makes it a promising candidate for the treatment of various injuries and diseases, including skin wounds, bone fractures, and cardiovascular diseases. Additionally, this protein has shown promising results in promoting the growth and repair of damaged nerves, making it a potential treatment for neurological disorders.

In conclusion, Recombinant Mouse GDF7 Protein is a valuable protein with diverse biological activities. Its structure, activity, and potential applications make it a crucial tool for scientific research and a potential therapeutic agent for various diseases. Further studies on this protein are needed to fully understand its functions and potential uses in medicine.

Recombinant Mouse GDF7 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse GDF7 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products