Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CST3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P21460
Molecular weight:
13.51 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Gly42–Ala140
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CST3 Protein, N-His

Product name ARO-P11025-100
Uniprot ID P21460
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA
Molecular weight 13.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly42-Ala140
Aliases /Synonyms Cystatin-C, Cst3, Cystatin-3
Reference ARO-P11025
Note For research use only.
Molecular Constructor
Gly42–Ala140
Product name ARO-P11025-1MG
Uniprot ID P21460
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA
Molecular weight 13.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly42-Ala140
Aliases /Synonyms Cystatin-C, Cst3, Cystatin-3
Reference ARO-P11025
Note For research use only.
Molecular Constructor
Gly42–Ala140
Product name ARO-P11025-50
Uniprot ID P21460
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA
Molecular weight 13.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly42-Ala140
Aliases /Synonyms Cystatin-C, Cst3, Cystatin-3
Reference ARO-P11025
Note For research use only.
Molecular Constructor
Gly42–Ala140

Introduction

Recombinant proteins have become essential tools in various fields of research, diagnostics, and therapeutics. These proteins are produced by genetically engineering host cells to express a specific gene of interest, resulting in the production of large quantities of the desired protein. One such recombinant protein is the Recombinant Mouse CST3 Protein, which has gained significant interest in recent years due to its unique structure and diverse applications.

Structure of Recombinant Mouse CST3 Protein

The Recombinant Mouse CST3 Protein is a 13.3 kDa protein composed of 120 amino acids. It belongs to the cystatin superfamily and is the mouse homolog of the human cystatin C protein. The primary structure of this protein is highly conserved among different species, with a sequence identity of 93% between mouse and human CST3 protein.

The three-dimensional structure of Recombinant Mouse CST3 Protein consists of a single domain with a Greek key motif, which is characteristic of cystatin proteins. This structure allows the protein to form a tight and stable binding with its target proteases, inhibiting their activity. Additionally, the protein has two disulfide bonds that further contribute to its stability.

Activity of Recombinant Mouse CST3 Protein

Recombinant Mouse CST3 Protein is a potent inhibitor of cysteine proteases, such as cathepsins B, H, K, L, and S. These proteases play crucial roles in various biological processes, including antigen processing, protein degradation, and tissue remodeling. By inhibiting these proteases, Recombinant Mouse CST3 Protein can regulate their activity and maintain protease homeostasis in the body.

The inhibitory activity of Recombinant Mouse CST3 Protein is mediated by its binding to the active site of the target protease, forming a reversible complex. This binding prevents the protease from interacting with its substrate, thereby inhibiting its activity. This mechanism of action makes Recombinant Mouse CST3 Protein a valuable tool in studying protease function and developing new therapeutic strategies for protease-related diseases.

Applications of Recombinant Mouse CST3 Protein

1. Research: Recombinant Mouse CST3 Protein is widely used in research as an inhibitor of cysteine proteases. It has been used in studies involving neurodegenerative diseases, cancer, and inflammation, where protease dysregulation is implicated.

2. Diagnostics: The level of cystatin C in blood and other body fluids is considered a reliable biomarker for kidney function. Recombinant Mouse CST3 Protein can be used to calibrate cystatin C assays, ensuring accurate and consistent results.

3. Therapeutics: The dysregulation of cysteine proteases has been linked to various diseases, making them potential therapeutic targets. Recombinant Mouse CST3 Protein can be used to develop protease inhibitors for the treatment of conditions such as Alzheimer’s disease, cancer, and rheumatoid arthritis.

4. Vaccine Adjuvant: Recombinant Mouse CST3 Protein has been shown to enhance the immune response to vaccines by promoting the uptake and presentation of antigens to immune cells. This property makes it a promising adjuvant for vaccine development.

Conclusion

In summary, Recombinant Mouse CST3 Protein is a valuable tool in scientific research, diagnostics, and therapeutics. Its unique structure, inhibitory activity, and diverse applications make it a highly sought-after protein in the scientific community. As research on cysteine proteases and their role in diseases continues to expand, the demand for Recombinant Mouse CST3 Protein is expected to increase, making it an essential protein in the field of recombinant proteins.

Recombinant Mouse CST3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CST3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products