Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse ST14 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P56677
Molecular weight:
28.70 kDa

Original price was: €341.00.Current price is: €275.00.

100ug 19% OFF + 275 loyalty points
Ser213–Ser449
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse ST14 Protein, N-His

Product name ARO-P11099-100
Uniprot ID P56677
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SCSFALHAHGAAVTRFTTPGFPNSPYPAHARCQWVLRGDADSVLSLTFRSFDVAPCDEHGSDLVTVYDSLSPMEPHAVVRLCGTFSPSYNLTFLSSQNVFLVTLITNTDRRHPGFEATFFQLPKMSSCGGFLSDTQGTFSSPYYPGHYPPNINCTWNIKVPNNRNVKVRFKLFYLVDPNVPVGSCTKDYVEINGEKYCGERSQFVVSSNSSKITVHFHSDHSYTDTGFLAEYLSYDS
Molecular weight 28.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser213-Ser449
Aliases /Synonyms Prss14, Suppressor of tumorigenicity 14 protein homolog, St14, Serine protease 14, Epithin
Reference ARO-P11099
Note For research use only.
Molecular Constructor
Ser213–Ser449
Product name ARO-P11099-1MG
Uniprot ID P56677
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SCSFALHAHGAAVTRFTTPGFPNSPYPAHARCQWVLRGDADSVLSLTFRSFDVAPCDEHGSDLVTVYDSLSPMEPHAVVRLCGTFSPSYNLTFLSSQNVFLVTLITNTDRRHPGFEATFFQLPKMSSCGGFLSDTQGTFSSPYYPGHYPPNINCTWNIKVPNNRNVKVRFKLFYLVDPNVPVGSCTKDYVEINGEKYCGERSQFVVSSNSSKITVHFHSDHSYTDTGFLAEYLSYDS
Molecular weight 28.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser213-Ser449
Aliases /Synonyms Prss14, Suppressor of tumorigenicity 14 protein homolog, St14, Serine protease 14, Epithin
Reference ARO-P11099
Note For research use only.
Molecular Constructor
Ser213–Ser449
Product name ARO-P11099-50
Uniprot ID P56677
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SCSFALHAHGAAVTRFTTPGFPNSPYPAHARCQWVLRGDADSVLSLTFRSFDVAPCDEHGSDLVTVYDSLSPMEPHAVVRLCGTFSPSYNLTFLSSQNVFLVTLITNTDRRHPGFEATFFQLPKMSSCGGFLSDTQGTFSSPYYPGHYPPNINCTWNIKVPNNRNVKVRFKLFYLVDPNVPVGSCTKDYVEINGEKYCGERSQFVVSSNSSKITVHFHSDHSYTDTGFLAEYLSYDS
Molecular weight 28.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser213-Ser449
Aliases /Synonyms Prss14, Suppressor of tumorigenicity 14 protein homolog, St14, Serine protease 14, Epithin
Reference ARO-P11099
Note For research use only.
Molecular Constructor
Ser213–Ser449

Introduction

The Recombinant Mouse ST14 Protein is a highly specialized protein that plays a crucial role in various biological processes. It is a type II transmembrane serine protease that is encoded by the ST14 gene in mice. This protein is also known as matriptase, and it is involved in the regulation of cell proliferation, migration, and survival. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse ST14 Protein.

Structure of Recombinant Mouse ST14 Protein

The Recombinant Mouse ST14 Protein is composed of 855 amino acids and has a molecular weight of approximately 95 kDa. It consists of three major domains: a cytoplasmic domain, a transmembrane domain, and an extracellular domain. The cytoplasmic domain is responsible for signal transduction, while the transmembrane domain anchors the protein to the cell membrane. The extracellular domain contains the serine protease catalytic domain, which is essential for the protein’s activity.

The crystal structure of the Recombinant Mouse ST14 Protein has been determined, and it has been found to be very similar to other members of the type II transmembrane serine protease family. It has a trypsin-like fold, with a catalytic triad consisting of His-302, Asp-345, and Ser-441 residues. This catalytic triad is responsible for the proteolytic activity of the protein.

Activity of Recombinant Mouse ST14 Protein

The Recombinant Mouse ST14 Protein is a potent serine protease that is involved in the activation of various proteins, including growth factors, cytokines, and receptors. It has been shown to cleave several substrates, such as pro-urokinase, pro-HGF, and pro-HB-EGF, which are important for cell proliferation and migration. Additionally, it can also activate other proteases, such as MMP-2 and MMP-9, which are involved in extracellular matrix remodeling.

The activity of Recombinant Mouse ST14 Protein is tightly regulated by its endogenous inhibitor, hepatocyte growth factor activator inhibitor-1 (HAI-1). HAI-1 binds to the extracellular domain of the protein and inhibits its proteolytic activity. This regulation is crucial for maintaining the balance between cell proliferation and apoptosis.

Applications of Recombinant Mouse ST14 Protein

The Recombinant Mouse ST14 Protein has a wide range of applications in both basic research and clinical settings. Its role in cell proliferation and migration makes it a potential target for cancer therapy. Inhibitors of this protein have been developed and are being tested in preclinical studies for their anti-tumor effects.

Moreover, Recombinant Mouse ST14 Protein has also been implicated in various inflammatory diseases, such as psoriasis and inflammatory bowel disease. It has been shown to activate the pro-inflammatory cytokine, IL-36, which is involved in the pathogenesis of these diseases. Therefore, inhibitors of this protein could be potential therapeutics for these conditions.

Furthermore, the Recombinant Mouse ST14 Protein has also been studied in the field of regenerative medicine. It has been shown to play a crucial role in the differentiation of embryonic stem cells into cardiomyocytes. This protein could potentially be used to improve the efficiency of stem cell differentiation protocols, leading to the development of new treatments for heart diseases.

Conclusion

The Recombinant Mouse ST14 Protein is a highly specialized serine protease that is involved in various biological processes. Its structure and activity have been extensively studied, and it has been found to have important roles in cell proliferation, migration, and survival. Its potential applications in cancer therapy, inflammatory diseases, and regenerative medicine make it an exciting target for further research. With ongoing studies, we can gain a better understanding of this protein and its potential for therapeutic interventions

Recombinant Mouse ST14 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse ST14 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products