Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD81 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P35762
Molecular weight:
37.98 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Phe113–Lys201
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD81 Protein, N-GST & C-His

Product name ARO-P10587-100
Uniprot ID P35762
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence FVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK
Molecular weight 37.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe113-Lys201
Aliases /Synonyms CD81 antigen, TSPAN28, Target of the antiproliferative antibody 1, Tspan-28, Tetraspanin-28, CD81, TAPA1, 26 kDa cell surface protein TAPA-1
Reference ARO-P10587
Note For research use only.
Molecular Constructor
Phe113–Lys201
Product name ARO-P10587-1MG
Uniprot ID P35762
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence FVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK
Molecular weight 37.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe113-Lys201
Aliases /Synonyms CD81 antigen, TSPAN28, Target of the antiproliferative antibody 1, Tspan-28, Tetraspanin-28, CD81, TAPA1, 26 kDa cell surface protein TAPA-1
Reference ARO-P10587
Note For research use only.
Molecular Constructor
Phe113–Lys201
Product name ARO-P10587-50
Uniprot ID P35762
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence FVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK
Molecular weight 37.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe113-Lys201
Aliases /Synonyms CD81 antigen, TSPAN28, Target of the antiproliferative antibody 1, Tspan-28, Tetraspanin-28, CD81, TAPA1, 26 kDa cell surface protein TAPA-1
Reference ARO-P10587
Note For research use only.
Molecular Constructor
Phe113–Lys201

Introduction

Recombinant Mouse CD81 Protein, also known as Cluster of Differentiation 81, is a transmembrane glycoprotein that is involved in various cellular processes such as cell adhesion, migration, and signaling. This protein is encoded by the CD81 gene and is a member of the tetraspanin family of proteins. Recombinant Mouse CD81 Protein has been extensively studied and has shown promising potential in various fields of research, making it a valuable tool for scientists.

Structure of Recombinant Mouse CD81 Protein

Recombinant Mouse CD81 Protein is composed of 236 amino acids and has a molecular weight of approximately 26 kDa. It contains four transmembrane domains, two extracellular loops, and two intracellular loops. The extracellular loops of this protein are highly glycosylated, which plays a crucial role in its function. The intracellular loops of Recombinant Mouse CD81 Protein interact with various signaling molecules and are responsible for its role in signal transduction.

Activity of Recombinant Mouse CD81 Protein

Recombinant Mouse CD81 Protein is a versatile protein that has been shown to have multiple functions in different cellular processes. One of its main functions is its role in cell adhesion. This protein has been found to interact with other cell adhesion molecules, such as integrins, and is involved in the formation of cell-cell contacts. Additionally, Recombinant Mouse CD81 Protein has been shown to play a role in cell migration, where it helps in the movement of cells by interacting with other proteins on the cell surface.

Moreover, Recombinant Mouse CD81 Protein has been found to be involved in signal transduction. It has been shown to interact with various signaling molecules, such as protein kinases, and is involved in the regulation of cell signaling pathways. This protein has also been found to play a role in the immune response, where it is involved in the activation of T cells and B cells.

Application of Recombinant Mouse CD81 Protein

The diverse functions of Recombinant Mouse CD81 Protein make it a valuable tool for scientists in various fields of research. One of the main applications of this protein is in the study of cell adhesion and migration. Its role in these processes makes it a valuable tool for understanding the mechanisms of cell movement and the formation of cell-cell contacts.

Furthermore, Recombinant Mouse CD81 Protein has been used in the study of signal transduction. Its interactions with various signaling molecules make it a valuable tool for understanding the complex signaling pathways involved in cellular processes. This protein has also been used in the study of the immune response, where it has been found to play a role in the activation of T cells and B cells.

In addition to its use in basic research, Recombinant Mouse CD81 Protein has also shown potential in clinical applications. It has been studied for its role in cancer progression and has been found to be overexpressed in certain types of cancer. This makes it a potential target for cancer therapy and diagnosis.

Conclusion

In summary, Recombinant Mouse CD81 Protein is a versatile protein with multiple functions in various cellular processes. Its structure, activity, and applications make it a valuable tool for scientists in different fields of research. From studying cell adhesion and migration to its potential use in cancer therapy, this protein continues to be a subject of interest and further research in the scientific community.

Recombinant Mouse CD81 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD81 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products