Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse ZNRF3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q5SSZ7
Molecular weight:
19.27 kDa

Original price was: €253.00.Current price is: €230.00.

50ug 9% OFF + 230 loyalty points
Lys53–Pro207
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse ZNRF3 Protein, N-His

Product name ARO-P10543-100
Uniprot ID Q5SSZ7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHLPP
Molecular weight 19.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys53-Pro207
Aliases /Synonyms KIAA1133, RNF203, RING-type E3 ubiquitin transferase ZNRF3, ZNRF3, RING finger protein 203, Zinc/RING finger protein 3, E3 ubiquitin-protein ligase ZNRF3
Reference ARO-P10543
Note For research use only.
Molecular Constructor
Lys53–Pro207
Product name ARO-P10543-1MG
Uniprot ID Q5SSZ7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHLPP
Molecular weight 19.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys53-Pro207
Aliases /Synonyms KIAA1133, RNF203, RING-type E3 ubiquitin transferase ZNRF3, ZNRF3, RING finger protein 203, Zinc/RING finger protein 3, E3 ubiquitin-protein ligase ZNRF3
Reference ARO-P10543
Note For research use only.
Molecular Constructor
Lys53–Pro207
Product name ARO-P10543-50
Uniprot ID Q5SSZ7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHLPP
Molecular weight 19.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys53-Pro207
Aliases /Synonyms KIAA1133, RNF203, RING-type E3 ubiquitin transferase ZNRF3, ZNRF3, RING finger protein 203, Zinc/RING finger protein 3, E3 ubiquitin-protein ligase ZNRF3
Reference ARO-P10543
Note For research use only.
Molecular Constructor
Lys53–Pro207

Introduction

Recombinant Mouse ZNRF3 Protein is a highly purified and bioactive protein that is produced through recombinant DNA technology. This protein is a member of the ZNRF family of E3 ubiquitin ligases and plays a crucial role in regulating the Wnt signaling pathway. It is commonly used as an antigen in various research studies and has diverse applications in the fields of cell biology, biochemistry, and immunology.

Structure of Recombinant Mouse ZNRF3 Protein

The recombinant mouse ZNRF3 protein is a 54 kDa protein consisting of 476 amino acids. It contains a RING finger domain, a transmembrane domain, and a C-terminal cytoplasmic domain. The RING finger domain is responsible for the E3 ubiquitin ligase activity of ZNRF3, while the transmembrane domain anchors the protein to the cell membrane. The cytoplasmic domain is involved in the interaction with other proteins in the Wnt signaling pathway.

Activity of Recombinant Mouse ZNRF3 Protein

The primary activity of recombinant mouse ZNRF3 protein is its role as an E3 ubiquitin ligase. This means that it catalyzes the transfer of ubiquitin molecules onto specific target proteins, leading to their degradation by the proteasome. ZNRF3 specifically targets Frizzled receptors, which are key components of the Wnt signaling pathway. By promoting the degradation of Frizzled receptors, ZNRF3 acts as a negative regulator of the Wnt signaling pathway.

Additionally, studies have shown that ZNRF3 also has a role in regulating the activity of other signaling pathways, such as the Notch and Hedgehog pathways. It has been found to interact with several proteins involved in these pathways, suggesting a broader role for ZNRF3 in cellular signaling.

Applications of Recombinant Mouse ZNRF3 Protein

1. Research on Wnt Signaling Pathway

Recombinant mouse ZNRF3 protein is commonly used as an antigen in studies related to the Wnt signaling pathway. It is used to investigate the role of ZNRF3 in regulating this pathway and its interactions with other components of the pathway. The protein can also be used to study the effects of ZNRF3 mutations on Wnt signaling and its implications in diseases such as cancer.

2. Protein-Protein Interaction Studies

As ZNRF3 interacts with various proteins in different signaling pathways, recombinant mouse ZNRF3 protein is a valuable tool for studying protein-protein interactions. It can be used in techniques such as co-immunoprecipitation and yeast two-hybrid assays to identify and characterize the binding partners of ZNRF3.

3. Drug Target Identification

Given the crucial role of ZNRF3 in regulating the Wnt signaling pathway, it has emerged as a potential drug target for diseases such as cancer. Recombinant mouse ZNRF3 protein can be used in high-throughput screening assays to identify small molecule inhibitors that can modulate its activity. This can aid in the development of novel therapeutic strategies for Wnt-related diseases.

4. Cell Signaling Studies

Recombinant mouse ZNRF3 protein can also be used in cell signaling studies to investigate the effects of ZNRF3 on cellular processes. It can be used to study the downstream effects of ZNRF3-mediated degradation of Frizzled receptors and its impact on cell proliferation, differentiation, and migration.

5. Biochemical Assays</h

Recombinant Mouse ZNRF3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse ZNRF3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products