Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD351/FCAMR Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q2TB54
Molecular weight:
40.54 kDa

Original price was: €392.00.Current price is: €329.00.

100ug 16% OFF + 329 loyalty points
Thr81–Ser191
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD351/FCAMR Protein, N-GST & C-His

Product name ARO-P10554-100
Uniprot ID Q2TB54
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TNALRGPRLVTGNTGGAVTIHCHYAPSSVNRHQRKYWCRLGSPLWICHTVVSTNQYTHPDYRGRAALTDIPQSGLFVVRLLRLSLGDVGLYRCGIGDRNDMLFFSVNLTVS
Molecular weight 40.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr81-Ser191
Aliases /Synonyms FCAMR, High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor, CD351, Fc alpha/mu receptor
Reference ARO-P10554
Note For research use only.
Molecular Constructor
Thr81–Ser191
Product name ARO-P10554-1MG
Uniprot ID Q2TB54
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TNALRGPRLVTGNTGGAVTIHCHYAPSSVNRHQRKYWCRLGSPLWICHTVVSTNQYTHPDYRGRAALTDIPQSGLFVVRLLRLSLGDVGLYRCGIGDRNDMLFFSVNLTVS
Molecular weight 40.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr81-Ser191
Aliases /Synonyms FCAMR, High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor, CD351, Fc alpha/mu receptor
Reference ARO-P10554
Note For research use only.
Molecular Constructor
Thr81–Ser191
Product name ARO-P10554-50
Uniprot ID Q2TB54
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TNALRGPRLVTGNTGGAVTIHCHYAPSSVNRHQRKYWCRLGSPLWICHTVVSTNQYTHPDYRGRAALTDIPQSGLFVVRLLRLSLGDVGLYRCGIGDRNDMLFFSVNLTVS
Molecular weight 40.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr81-Ser191
Aliases /Synonyms FCAMR, High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor, CD351, Fc alpha/mu receptor
Reference ARO-P10554
Note For research use only.
Molecular Constructor
Thr81–Ser191

Introduction

Recombinant Mouse CD351/FCAMR Protein, also known as Fc alpha/mu receptor (FCAMR), is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily. It is encoded by the FCAMR gene and is primarily expressed on the surface of immune cells, including B cells, macrophages, and dendritic cells. This protein plays a crucial role in immune response and has been studied extensively for its potential therapeutic applications.

Structure of Recombinant Mouse CD351/FCAMR Protein

Recombinant Mouse CD351/FCAMR Protein is a type I transmembrane protein with a molecular weight of approximately 60 kDa. It is composed of a single chain of 390 amino acids, with a signal peptide at the N-terminus and a transmembrane region at the C-terminus. The extracellular region of the protein contains two immunoglobulin-like domains, an N-terminal V-type domain and a C-terminal C2-type domain, which are connected by a stalk region. The cytoplasmic tail of the protein contains a conserved immunoreceptor tyrosine-based activation motif (ITAM), which is responsible for initiating intracellular signaling upon ligand binding.

Activity of Recombinant Mouse CD351/FCAMR Protein

Recombinant Mouse CD351/FCAMR Protein is a receptor for both IgA and IgM antibodies. It binds to the Fc portion of these antibodies, specifically to the heavy chain constant region of IgA and the mu chain constant region of IgM. This binding triggers the activation of immune cells, leading to various immune responses such as phagocytosis, cytokine production, and antigen presentation. Additionally, studies have shown that this protein can also bind to other ligands, such as bacterial and viral antigens, and play a role in innate immunity.

Application of Recombinant Mouse CD351/FCAMR Protein

Recombinant Mouse CD351/FCAMR Protein has been extensively studied for its potential therapeutic applications. One of the main applications is in the treatment of autoimmune diseases. As this protein is involved in immune regulation, it has been proposed as a potential target for autoimmune diseases, such as rheumatoid arthritis and lupus. In fact, studies have shown that blocking the activity of this protein can suppress the development of autoimmune diseases in animal models.

Another potential application of Recombinant Mouse CD351/FCAMR Protein is in cancer immunotherapy. It has been found that this protein is expressed at high levels in certain types of cancer cells, including breast and colon cancer. This makes it a potential target for immunotherapy, where the protein can be targeted with specific antibodies or used as a chimeric antigen receptor (CAR) in adoptive T cell therapy.

In addition, Recombinant Mouse CD351/FCAMR Protein has also been studied for its role in infectious diseases. As it can bind to bacterial and viral antigens, it has been suggested as a potential target for developing vaccines against these pathogens. Furthermore, this protein has also been shown to play a role in viral entry into host cells, making it a potential target for antiviral therapies.

Conclusion

In summary, Recombinant Mouse CD351/FCAMR Protein is a transmembrane glycoprotein that plays a crucial role in immune response. Its structure, activity, and potential applications make it a promising target for various therapeutic interventions. Further research and development in this field may lead to the development of novel treatments for autoimmune diseases, cancer, and infectious diseases.

Recombinant Mouse CD351/FCAMR Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD351/FCAMR Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products