Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD276/B7-H3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q8VE98
Molecular weight:
25.43 kDa

Original price was: €283.00.Current price is: €230.00.

50ug 19% OFF + 230 loyalty points
Thr26–Gly239
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD276/B7-H3 Protein, N-His

Product name ARO-P11117-100
Uniprot ID Q8VE98
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITG
Molecular weight 25.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr26-Gly239
Aliases /Synonyms Cd276, B7 homolog 3, CD276 antigen, CD276, B7-H3, B7h3, Costimulatory molecule
Reference ARO-P11117
Note For research use only.
Molecular Constructor
Thr26–Gly239
Product name ARO-P11117-1MG
Uniprot ID Q8VE98
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITG
Molecular weight 25.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr26-Gly239
Aliases /Synonyms Cd276, B7 homolog 3, CD276 antigen, CD276, B7-H3, B7h3, Costimulatory molecule
Reference ARO-P11117
Note For research use only.
Molecular Constructor
Thr26–Gly239
Product name ARO-P11117-50
Uniprot ID Q8VE98
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITG
Molecular weight 25.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr26-Gly239
Aliases /Synonyms Cd276, B7 homolog 3, CD276 antigen, CD276, B7-H3, B7h3, Costimulatory molecule
Reference ARO-P11117
Note For research use only.
Molecular Constructor
Thr26–Gly239

Introduction

Recombinant proteins have become essential tools in various fields of life sciences, including biotechnology, medicine, and research. One such protein is the Recombinant Mouse CD276/B7-H3 Protein, which has gained significant attention due to its unique structure and diverse functions. In this article, we will discuss the structure, activity, and application of this recombinant protein in detail.

Structure of Recombinant Mouse CD276/B7-H3 Protein

The Recombinant Mouse CD276/B7-H3 Protein is a member of the B7 family of immune checkpoint molecules. It is a type I transmembrane protein that consists of 595 amino acids and has a molecular weight of approximately 60 kDa. The protein contains a single extracellular IgV-like domain, a transmembrane domain, and a cytoplasmic domain. The extracellular domain of CD276 is highly glycosylated, which contributes to its stability and function.

Activity of Recombinant Mouse CD276/B7-H3 Protein

The primary function of Recombinant Mouse CD276/B7-H3 Protein is to regulate immune responses. It is expressed on the surface of antigen-presenting cells, such as dendritic cells, macrophages, and B cells, and can also be found on some tumor cells. CD276 interacts with its receptor, B7-H3, which is expressed on T cells, and modulates T cell activation and proliferation. This interaction can either enhance or suppress T cell responses, depending on the context and immune microenvironment.

Moreover, Recombinant Mouse CD276/B7-H3 Protein has been shown to play a role in tumor immunity. It can act as a co-stimulatory molecule and promote anti-tumor immune responses by activating CD8+ T cells and natural killer cells. On the other hand, it can also suppress immune responses and promote tumor growth by inducing regulatory T cells and inhibiting the function of effector T cells. This dual role of CD276 makes it a potential target for cancer immunotherapy.

Application of Recombinant Mouse CD276/B7-H3 Protein

The unique structure and diverse functions of Recombinant Mouse CD276/B7-H3 Protein make it a valuable tool for various applications in the fields of biotechnology and medicine. One of the primary applications of this protein is in cancer research. Its involvement in tumor immunity and potential as a target for immunotherapy have made it a subject of interest for scientists studying cancer biology.

Furthermore, Recombinant Mouse CD276/B7-H3 Protein has also been used in the development of diagnostic and therapeutic tools for cancer. Its expression on tumor cells makes it a potential biomarker for cancer diagnosis, and its ability to modulate immune responses can be utilized for developing novel immunotherapies for cancer treatment.

In addition to cancer, Recombinant Mouse CD276/B7-H3 Protein has also been studied in other diseases, such as autoimmune disorders and infectious diseases. Its role in regulating immune responses can be harnessed for the development of therapies for these conditions.

Conclusion

In summary, Recombinant Mouse CD276/B7-H3 Protein is a unique and versatile protein that plays a crucial role in regulating immune responses. Its structure, activity, and diverse functions make it a valuable tool for various applications, particularly in cancer research and therapy. Further studies on this protein are needed to fully understand its potential and develop more effective treatments for diseases.

Recombinant Mouse CD276/B7-H3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD276/B7-H3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products