Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CIRBP Protein, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P60824
Molecular weight:
45.30 kDa

Original price was: €241.00.Current price is: €193.00.

50ug 20% OFF + 193 loyalty points
Ala2–Glu172
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CIRBP Protein, N-GST

Product name ARO-P12744-100
Uniprot ID P60824
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
Molecular weight 45.30 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Glu172
Aliases /Synonyms Cold-inducible RNA-binding protein, A18 hnRNP, Glycine-rich RNA-binding protein CIRP, Cirbp, Cirp
Reference ARO-P12744
Note For research use only.
Molecular Constructor
Ala2–Glu172
Product name ARO-P12744-1MG
Uniprot ID P60824
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
Molecular weight 45.30 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Glu172
Aliases /Synonyms Cold-inducible RNA-binding protein, A18 hnRNP, Glycine-rich RNA-binding protein CIRP, Cirbp, Cirp
Reference ARO-P12744
Note For research use only.
Molecular Constructor
Ala2–Glu172
Product name ARO-P12744-50
Uniprot ID P60824
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
Molecular weight 45.30 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Glu172
Aliases /Synonyms Cold-inducible RNA-binding protein, A18 hnRNP, Glycine-rich RNA-binding protein CIRP, Cirbp, Cirp
Reference ARO-P12744
Note For research use only.
Molecular Constructor
Ala2–Glu172

Recombinant Mouse CIRBP Protein, N-GST

There are no reviews yet.

Be the first to review “Recombinant Mouse CIRBP Protein, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products