Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CCL28/MEC Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9JIL2
Molecular weight:
8.89 kDa

Original price was: €265.00.Current price is: €230.00.

50ug 13% OFF + 230 loyalty points
His37–Gly94
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CCL28/MEC Protein, N-His

Product name ARO-P11110-100
Uniprot ID Q9JIL2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNG
Molecular weight 8.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His37-Gly94
Aliases /Synonyms Scya28, C-C motif chemokine 28, Small-inducible cytokine A28, Ccl28
Reference ARO-P11110
Note For research use only.
Molecular Constructor
His37–Gly94
Product name ARO-P11110-1MG
Uniprot ID Q9JIL2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNG
Molecular weight 8.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His37-Gly94
Aliases /Synonyms Scya28, C-C motif chemokine 28, Small-inducible cytokine A28, Ccl28
Reference ARO-P11110
Note For research use only.
Molecular Constructor
His37–Gly94
Product name ARO-P11110-50
Uniprot ID Q9JIL2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNG
Molecular weight 8.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His37-Gly94
Aliases /Synonyms Scya28, C-C motif chemokine 28, Small-inducible cytokine A28, Ccl28
Reference ARO-P11110
Note For research use only.
Molecular Constructor
His37–Gly94

Introduction

Recombinant Mouse CCL28/MEC Protein is a type of protein that is produced through genetic engineering techniques. It is also known as Mouse Epithelial Cell-Derived Neutrophil-Activating Peptide 78 (MEC/CCL28) and belongs to the chemokine family of proteins. This protein plays an important role in the immune response and has various applications in the field of immunology and biotechnology.

Structure

Recombinant Mouse CCL28/MEC Protein is a small protein with a molecular weight of approximately 8.5 kDa. It is composed of 74 amino acids and has a conserved cysteine motif at the N-terminus, which is characteristic of all chemokines. The protein has a three-dimensional structure that is stabilized by disulfide bonds between the cysteine residues. It also has a flexible loop region that is important for its receptor binding activity.

Activity

Recombinant Mouse CCL28/MEC Protein is a potent chemoattractant for immune cells, particularly neutrophils and lymphocytes. It binds to its specific receptor, CCR10, which is expressed on the surface of these cells. This interaction triggers a signaling cascade, leading to the migration of immune cells towards the site of infection or inflammation. Additionally, this protein also has antimicrobial activity and can directly inhibit the growth of certain bacteria and fungi.

Application

Recombinant Mouse CCL28/MEC Protein has various applications in both research and therapeutic settings. Some of the key applications are:

1. Immunology research

The role of chemokines in the immune response has been extensively studied, and Recombinant Mouse CCL28/MEC Protein is a valuable tool for studying the mechanisms involved. Its ability to attract immune cells and its antimicrobial activity make it a suitable candidate for investigating the role of chemokines in host defense against pathogens. It can also be used to study the role of CCR10 in immune cell migration and activation.

2. Inflammatory diseases

Chemokines are known to play a crucial role in the development and progression of inflammatory diseases, such as rheumatoid arthritis and inflammatory bowel disease. Recombinant Mouse CCL28/MEC Protein has been shown to be elevated in these conditions, and its use as a biomarker for disease activity has been proposed. Additionally, this protein can also be used as a therapeutic target for these diseases, as blocking its activity can potentially reduce inflammation.

3. Wound healing

The recruitment of immune cells is essential for the healing process of wounds. Recombinant Mouse CCL28/MEC Protein has been shown to promote the migration of immune cells to the site of injury, thereby aiding in the wound healing process. It has also been suggested as a potential therapeutic agent for chronic wounds, such as diabetic ulcers, where the recruitment of immune cells is impaired.

4. Vaccine development

Recombinant Mouse CCL28/MEC Protein has been investigated as an adjuvant for vaccines. Adjuvants are substances that enhance the immune response to a vaccine, and chemokines have been shown to have adjuvant properties. This protein has been shown to enhance the immune response to various vaccines, including influenza and hepatitis B, making it a promising candidate for future vaccine development.

5. Biotechnology

The production of Recombinant Mouse CCL28/MEC Protein through genetic engineering techniques has made it readily available for use in various biotechnological applications. It can be used as a standard for quantification in assays that measure chemokine activity. It can also be used in the development of new chemokine-based therapeutics, such as CCR10 antagonists for inflammatory diseases.

Conclusion

In summary, Recombinant Mouse CCL28/MEC Protein is a small protein with

Recombinant Mouse CCL28/MEC Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CCL28/MEC Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products