Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse DAND5 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q76LW6
Molecular weight:
42.40 kDa

Original price was: €245.00.Current price is: €193.00.

50ug 21% OFF + 193 loyalty points
Ser55–Leu185
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse DAND5 Protein, N-GST & C-His

Product name ARO-P10954-100
Uniprot ID Q76LW6
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SWEAFLGLQNKQQGTGELQGGGQRVAAGVPLPLAPQEVLQETCKALSFVQVISRPGCTSARVLNHLCFGRCSSFYIPSSDPTPVVFCNSCVPARKRWTSVTLWCGAGQLASPRRVRISTVLVQKCQCRPKL
Molecular weight 42.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser55-Leu185
Aliases /Synonyms DAN domain family member 5, Cerberus-like protein 2, Dand5, Cerl-2, Cerl2, Sp1
Reference ARO-P10954
Note For research use only.
Molecular Constructor
Ser55–Leu185
Product name ARO-P10954-1MG
Uniprot ID Q76LW6
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SWEAFLGLQNKQQGTGELQGGGQRVAAGVPLPLAPQEVLQETCKALSFVQVISRPGCTSARVLNHLCFGRCSSFYIPSSDPTPVVFCNSCVPARKRWTSVTLWCGAGQLASPRRVRISTVLVQKCQCRPKL
Molecular weight 42.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser55-Leu185
Aliases /Synonyms DAN domain family member 5, Cerberus-like protein 2, Dand5, Cerl-2, Cerl2, Sp1
Reference ARO-P10954
Note For research use only.
Molecular Constructor
Ser55–Leu185
Product name ARO-P10954-50
Uniprot ID Q76LW6
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SWEAFLGLQNKQQGTGELQGGGQRVAAGVPLPLAPQEVLQETCKALSFVQVISRPGCTSARVLNHLCFGRCSSFYIPSSDPTPVVFCNSCVPARKRWTSVTLWCGAGQLASPRRVRISTVLVQKCQCRPKL
Molecular weight 42.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser55-Leu185
Aliases /Synonyms DAN domain family member 5, Cerberus-like protein 2, Dand5, Cerl-2, Cerl2, Sp1
Reference ARO-P10954
Note For research use only.
Molecular Constructor
Ser55–Leu185

Introduction

Recombinant Mouse DAND5 Protein, also known as Gremlin-2, is a member of the DAN family of BMP (bone morphogenetic protein) antagonists. It is a secreted protein that plays a crucial role in regulating the activity of BMP signaling, which is involved in various cellular processes such as cell proliferation, differentiation, and apoptosis. Recombinant Mouse DAND5 Protein is a valuable tool for studying the role of BMP signaling in different biological systems and has potential applications in various fields, including developmental biology, cancer research, and regenerative medicine.

Structure of Recombinant Mouse DAND5 Protein

Recombinant Mouse DAND5 Protein is a 189-amino acid protein with a molecular weight of approximately 21 kDa. It contains a highly conserved cysteine knot domain, which is essential for its binding to BMP ligands. The cysteine knot domain consists of six cysteine residues that form three disulfide bonds, giving the protein a compact and stable structure. Recombinant Mouse DAND5 Protein also has a C-terminal domain that is responsible for its secretion and interaction with other proteins.

Activity of Recombinant Mouse DAND5 Protein

Recombinant Mouse DAND5 Protein is a potent antagonist of BMP signaling. It binds to BMP ligands with high affinity and prevents their interaction with their receptors, thereby inhibiting BMP signaling. This results in the downregulation of downstream target genes involved in cell proliferation, differentiation, and apoptosis. Recombinant Mouse DAND5 Protein has been shown to block BMP-induced osteogenic differentiation of mesenchymal stem cells and inhibit BMP-mediated angiogenesis in vitro. It also plays a crucial role in regulating embryonic development, as demonstrated by studies in knockout mice, where the absence of DAND5 leads to developmental defects.

Application of Recombinant Mouse DAND5 Protein

Recombinant Mouse DAND5 Protein has various applications in both basic and applied research. Its ability to inhibit BMP signaling makes it a valuable tool for studying the role of BMPs in different cellular processes. In developmental biology, Recombinant Mouse DAND5 Protein can be used to investigate the effects of BMP signaling on embryonic development. It can also be used in cancer research, as BMP signaling has been linked to tumor growth and progression. Recombinant Mouse DAND5 Protein may have potential therapeutic applications in cancer treatment by inhibiting BMP-induced tumor growth.

In regenerative medicine, Recombinant Mouse DAND5 Protein can be used to regulate BMP signaling and promote tissue regeneration. For example, in bone tissue engineering, it can be used to inhibit BMP signaling and prevent unwanted bone formation. In cartilage repair, it can be used to promote chondrogenesis by blocking BMP signaling, which inhibits cartilage formation. Recombinant Mouse DAND5 Protein may have potential applications in other tissue engineering strategies, such as wound healing and organ regeneration.

Conclusion

Recombinant Mouse DAND5 Protein is a valuable tool for studying the role of BMP signaling in various biological processes. Its structure, activity, and potential applications make it a promising candidate for research in developmental biology, cancer, and regenerative medicine. As our understanding of the complex role of BMP signaling continues to grow, the importance of Recombinant Mouse DAND5 Protein as a research tool will only increase.

Recombinant Mouse DAND5 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Mouse DAND5 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products