Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CRISP2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P16563
Molecular weight:
27.35 kDa

Original price was: €336.00.Current price is: €275.00.

100ug 18% OFF + 275 loyalty points
Lys23–His243
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CRISP2 Protein, N-His

Product name ARO-P10952-100
Uniprot ID P16563
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KDPDFTSLLTNQLQVQREIVNKHNELRRSVNPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKINIRCGENLYMSTDPTLWSTVIQSWYNENEDFVYGVGAKPNSAVGHYTQLVWYSSFKIGCGIAYCPNQDNLKYFYVCHYCPMGNNVMKKSTPYQQGTPCASCPNNCENGLCTNSCDFEDLLSNCESLKTSAGCKHELLKTKCQATCLCEDKIH
Molecular weight 27.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys23-His243
Aliases /Synonyms Tpx-1, CRISP-2, Cysteine-rich secretory protein 2, Crisp2, Testis-specific protein TPX-1, Tpx1
Reference ARO-P10952
Note For research use only.
Molecular Constructor
Lys23–His243
Product name ARO-P10952-1MG
Uniprot ID P16563
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KDPDFTSLLTNQLQVQREIVNKHNELRRSVNPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKINIRCGENLYMSTDPTLWSTVIQSWYNENEDFVYGVGAKPNSAVGHYTQLVWYSSFKIGCGIAYCPNQDNLKYFYVCHYCPMGNNVMKKSTPYQQGTPCASCPNNCENGLCTNSCDFEDLLSNCESLKTSAGCKHELLKTKCQATCLCEDKIH
Molecular weight 27.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys23-His243
Aliases /Synonyms Tpx-1, CRISP-2, Cysteine-rich secretory protein 2, Crisp2, Testis-specific protein TPX-1, Tpx1
Reference ARO-P10952
Note For research use only.
Molecular Constructor
Lys23–His243
Product name ARO-P10952-50
Uniprot ID P16563
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KDPDFTSLLTNQLQVQREIVNKHNELRRSVNPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKINIRCGENLYMSTDPTLWSTVIQSWYNENEDFVYGVGAKPNSAVGHYTQLVWYSSFKIGCGIAYCPNQDNLKYFYVCHYCPMGNNVMKKSTPYQQGTPCASCPNNCENGLCTNSCDFEDLLSNCESLKTSAGCKHELLKTKCQATCLCEDKIH
Molecular weight 27.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys23-His243
Aliases /Synonyms Tpx-1, CRISP-2, Cysteine-rich secretory protein 2, Crisp2, Testis-specific protein TPX-1, Tpx1
Reference ARO-P10952
Note For research use only.
Molecular Constructor
Lys23–His243

Introduction

Recombinant Mouse CRISP2 Protein is a type of recombinant protein that has been extensively studied in recent years due to its diverse functions and potential applications in various fields. This protein belongs to the CRISP (Cysteine-Rich Secretory Proteins) family and is highly expressed in the male reproductive system, specifically in the testes and epididymis. In this article, we will provide a scientific description of the structure, activity, and applications of Recombinant Mouse CRISP2 Protein.

Structure

Recombinant Mouse CRISP2 Protein is a 25 kDa protein that consists of 222 amino acids. It has a conserved cysteine-rich domain, which is characteristic of the CRISP family. This domain is responsible for the protein’s structure and function, and it contains 16 cysteine residues that form disulfide bonds to stabilize the protein’s tertiary structure.

The crystal structure of Recombinant Mouse CRISP2 Protein has been determined, revealing a compact globular protein with a central core and two protruding loops. This structure is similar to other CRISP family members, indicating a conserved function among these proteins.

Activity

Recombinant Mouse CRISP2 Protein has been shown to have several activities, including ion channel blocking, protease inhibition, and sperm binding. These activities are crucial for the protein’s role in male reproductive function.

One of the most well-studied activities of Recombinant Mouse CRISP2 Protein is its ability to block ion channels. It has been shown to inhibit both voltage-gated and ligand-gated ion channels, which are essential for sperm motility and fertilization. This activity is thought to be due to the protein’s ability to interact with the lipid membrane of the sperm cell, disrupting ion channel function.

In addition to ion channel blocking, Recombinant Mouse CRISP2 Protein also exhibits protease inhibition activity. It has been shown to inhibit several proteases, including trypsin and chymotrypsin, which are involved in sperm maturation and function. By inhibiting these proteases, Recombinant Mouse CRISP2 Protein may play a role in regulating sperm development and function.

Another important activity of Recombinant Mouse CRISP2 Protein is its ability to bind to sperm cells. This binding is thought to be mediated by the protein’s interaction with glycosaminoglycans on the surface of the sperm cell. This activity may be crucial for sperm-egg interaction and fertilization.

Application

Recombinant Mouse CRISP2 Protein has potential applications in various fields due to its diverse activities and functions. One of the most promising applications is in male contraception. By targeting sperm function and development, Recombinant Mouse CRISP2 Protein may serve as a potential target for male contraceptive drugs.

In addition to contraception, Recombinant Mouse CRISP2 Protein may also have applications in fertility treatments. It has been shown to play a role in sperm-egg interaction and fertilization, making it a potential target for improving fertility in both males and females.

Furthermore, Recombinant Mouse CRISP2 Protein has been studied for its potential role in the treatment of certain cancers. It has been shown to inhibit the growth and metastasis of prostate cancer cells, making it a potential therapeutic target for this type of cancer.

Conclusion

In summary, Recombinant Mouse CRISP2 Protein is a 25 kDa protein with a conserved cysteine-rich domain. It exhibits various activities, including ion channel blocking, protease inhibition, and sperm binding. These activities make it a potential target for male contraception, fertility treatments, and cancer therapy. Continued research on this protein may lead to the development of novel treatments and therapies in the future.

Recombinant Mouse CRISP2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CRISP2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products