Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ZC3H4 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UPT8
Molecular weight:
38.12 kDa

Original price was: €235.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Glu417–Gly503
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ZC3H4 Protein, N-GST & C-His

Product name ARO-P12169-100
Uniprot ID Q9UPT8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ELPKKRELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLDKMLADDAEAGAEDEKEVEELKKQG
Molecular weight 38.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu417-Gly503
Aliases /Synonyms KIAA1064, C19orf7, ZC3H4, Zinc finger CCCH domain-containing protein 4
Reference ARO-P12169
Note For research use only.
Molecular Constructor
Glu417–Gly503
Product name ARO-P12169-1MG
Uniprot ID Q9UPT8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ELPKKRELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLDKMLADDAEAGAEDEKEVEELKKQG
Molecular weight 38.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu417-Gly503
Aliases /Synonyms KIAA1064, C19orf7, ZC3H4, Zinc finger CCCH domain-containing protein 4
Reference ARO-P12169
Note For research use only.
Molecular Constructor
Glu417–Gly503
Product name ARO-P12169-50
Uniprot ID Q9UPT8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ELPKKRELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLDKMLADDAEAGAEDEKEVEELKKQG
Molecular weight 38.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu417-Gly503
Aliases /Synonyms KIAA1064, C19orf7, ZC3H4, Zinc finger CCCH domain-containing protein 4
Reference ARO-P12169
Note For research use only.
Molecular Constructor
Glu417–Gly503

Introduction

Recombinant Human ZC3H4 Protein, also known as Zinc Finger CCCH-Type Containing 4 Protein, is a recently discovered protein that plays a crucial role in various cellular processes. This protein is encoded by the ZC3H4 gene and belongs to the CCCH zinc finger protein family. Recombinant Human ZC3H4 Protein is produced through recombinant DNA technology and has gained significant attention in the scientific community due to its diverse structure and functions.

Structure of Recombinant Human ZC3H4 Protein

The primary structure of Recombinant Human ZC3H4 Protein consists of 263 amino acids, with a molecular weight of approximately 30 kDa. It contains three CCCH-type zinc finger domains, which are known to be essential for RNA binding and protein-protein interactions. These zinc finger domains are connected by linker regions, allowing for flexibility and dynamic interactions with other molecules. The secondary structure of Recombinant Human ZC3H4 Protein is predominantly alpha-helical, with some beta-strands present as well.

Activity of Recombinant Human ZC3H4 Protein

Recombinant Human ZC3H4 Protein has been found to have multiple activities within the cell. Its primary function is to bind to RNA molecules and regulate their stability and translation. It has been shown to interact with various RNA-binding proteins, including HuR and PARN, to modulate RNA metabolism and gene expression. Additionally, Recombinant Human ZC3H4 Protein has been found to play a role in cell proliferation and differentiation, as well as DNA damage response and repair.

Application of Recombinant Human ZC3H4 Protein

The diverse structure and activity of Recombinant Human ZC3H4 Protein make it a valuable tool in various research areas. Its ability to bind to RNA molecules makes it a crucial player in studying post-transcriptional gene regulation. It has been extensively used in studies related to RNA metabolism, including RNA stability, translation, and localization. Furthermore, Recombinant Human ZC3H4 Protein has been implicated in diseases such as cancer and neurodegenerative disorders, making it a potential therapeutic target.

Recombinant Protein Production

Recombinant Human ZC3H4 Protein is produced through recombinant DNA technology, which involves inserting the ZC3H4 gene into a suitable expression vector and introducing it into host cells, such as bacteria or mammalian cells. The recombinant protein is then purified using various techniques, such as chromatography, to obtain a highly pure and active form of the protein.

Antigen Detection

Recombinant Human ZC3H4 Protein has also been used as an antigen in various immunological studies. Antibodies against this protein have been developed and used for antigen detection and quantification in different tissues and cell types. This has allowed for a better understanding of the expression and localization of Recombinant Human ZC3H4 Protein in various physiological and pathological conditions.

Conclusion

In conclusion, Recombinant Human ZC3H4 Protein is a versatile protein with a unique structure and diverse functions. Its role in regulating RNA metabolism and gene expression makes it a valuable tool in various research areas, including post-transcriptional gene regulation and disease studies. With its potential therapeutic applications, Recombinant Human ZC3H4 Protein holds promise for future research and development in the field of biotechnology.

Recombinant Human ZC3H4 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human ZC3H4 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products