Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HOXC10 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NYD6
Molecular weight:
20.82 kDa

Original price was: €222.00.Current price is: €193.00.

50ug 13% OFF + 193 loyalty points
Thr276–Thr342
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HOXC10 Protein, N-His-SUMO

Product name ARO-P11893-100
Uniprot ID Q9NYD6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKHQTLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRRMKLKKMNRENRIRELTSNFNFT
Molecular weight 20.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr276-Thr342
Aliases /Synonyms HOX3I, Homeobox protein Hox-C10, Homeobox protein Hox-3I, HOXC10
Reference ARO-P11893
Note For research use only.
Molecular Constructor
Thr276–Thr342
Product name ARO-P11893-1MG
Uniprot ID Q9NYD6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKHQTLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRRMKLKKMNRENRIRELTSNFNFT
Molecular weight 20.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr276-Thr342
Aliases /Synonyms HOX3I, Homeobox protein Hox-C10, Homeobox protein Hox-3I, HOXC10
Reference ARO-P11893
Note For research use only.
Molecular Constructor
Thr276–Thr342
Product name ARO-P11893-50
Uniprot ID Q9NYD6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKHQTLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRRMKLKKMNRENRIRELTSNFNFT
Molecular weight 20.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr276-Thr342
Aliases /Synonyms HOX3I, Homeobox protein Hox-C10, Homeobox protein Hox-3I, HOXC10
Reference ARO-P11893
Note For research use only.
Molecular Constructor
Thr276–Thr342

Introduction

Recombinant Human HOXC10 Protein, also known as Homeobox C10, is a protein that is encoded by the HOXC10 gene. It belongs to the homeobox family of transcription factors and is involved in the regulation of gene expression and development. This protein has been extensively studied for its structure, activity, and potential applications in various fields.

Structure of Recombinant Human HOXC10 Protein

The Recombinant Human HOXC10 Protein is a 356 amino acid long protein with a molecular weight of 39.5 kDa. It contains a homeobox domain, which is a conserved DNA-binding domain found in many transcription factors. This domain is responsible for the specific binding of HOXC10 to DNA sequences and regulates the expression of target genes.

Activity of Recombinant Human HOXC10 Protein

The primary function of Recombinant Human HOXC10 Protein is to regulate gene expression during embryonic development. It is involved in the formation of the body plan and the differentiation of various tissues and organs. HOXC10 has also been shown to play a role in the development of the nervous system, skeletal system, and reproductive system.

In addition to its role in development, Recombinant Human HOXC10 Protein has been found to be important in cancer progression. Studies have shown that HOXC10 is overexpressed in various types of cancer, including breast, lung, and prostate cancer. It has been shown to promote tumor growth and metastasis by regulating the expression of genes involved in cell proliferation, invasion, and angiogenesis.

Applications of Recombinant Human HOXC10 Protein

Recombinant Human HOXC10 Protein has a wide range of potential applications in both basic research and clinical settings. Due to its role in development, this protein has been studied for its potential in tissue regeneration and repair. It has been shown to promote the differentiation of stem cells into specific cell types, making it a promising candidate for regenerative medicine.

In cancer research, Recombinant Human HOXC10 Protein has been used as a biomarker for cancer diagnosis and prognosis. Its overexpression in various types of cancer makes it a potential target for cancer therapy. In fact, studies have shown that inhibiting HOXC10 expression can suppress tumor growth and metastasis, making it a promising target for anticancer drugs.

Furthermore, Recombinant Human HOXC10 Protein has been studied for its potential in gene therapy. Due to its ability to regulate gene expression, it has been used to deliver therapeutic genes to specific tissues or cells. This has the potential to treat genetic disorders and other diseases at the molecular level.

Conclusion

In summary, Recombinant Human HOXC10 Protein is a crucial protein involved in the regulation of gene expression and development. Its structure, activity, and potential applications have been extensively studied, making it a promising candidate for various fields of research. From tissue regeneration to cancer therapy and gene therapy, this protein has the potential to revolutionize the way we treat diseases. Further research and development in this area will undoubtedly uncover more exciting applications for Recombinant Human HOXC10 Protein.

Recombinant Human HOXC10 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human HOXC10 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products