Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD85f-LILRA5 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
A6NI73
Molecular weight:
28.15 kDa

379.00

100ug + 379 loyalty points
Gly42–Arg268 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD85f-LILRA5 recombinant protein

Product name Human CD85f-LILRA5 recombinant protein
Uniprot ID A6NI73
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Molecular weight 28.15 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly42-Arg268
Aliases /Synonyms Leukocyte immunoglobulin-like receptor subfamily A member 5, Immunoglobulin-like transcript 11, ILT-11, Leukocyte immunoglobulin-like receptor 9, LIR9, CD85f, LIR-9, LILRB7, CD85 antigen-like family member F, LILRA5, ILT11
Reference PX-P6148
Note For research use only
Molecular Constructor
Gly42–Arg268 His

Human CD85f-LILRA5 recombinant protein

There are no reviews yet.

Be the first to review “Human CD85f-LILRA5 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products