Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human UHRF1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96T88
Molecular weight:
29.27 kDa

Original price was: €344.00.Current price is: €275.00.

100ug 20% OFF + 275 loyalty points
Leu134–Asp366
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human UHRF1 Protein, N-His

Product name ARO-P12419-100
Uniprot ID Q96T88
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Molecular weight 29.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu134-Asp366
Aliases /Synonyms Nuclear zinc finger protein Np95, RING-type E3 ubiquitin transferase UHRF1, RING finger protein 106, Transcription factor ICBP90, E3 ubiquitin-protein ligase UHRF1, Ubiquitin-like PHD and RING finger domain-containing protein 1, NP95, HuNp95, Nuclear protein 95, RNF106, ICBP90, hNp95, UHRF1, Inverted CCAAT box-binding protein of 90 kDa, hUHRF1, Ubiquitin-like-containing PHD and RING finger domains protein 1
Reference ARO-P12419
Note For research use only.
Molecular Constructor
Leu134–Asp366
Product name ARO-P12419-1MG
Uniprot ID Q96T88
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Molecular weight 29.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu134-Asp366
Aliases /Synonyms Nuclear zinc finger protein Np95, RING-type E3 ubiquitin transferase UHRF1, RING finger protein 106, Transcription factor ICBP90, E3 ubiquitin-protein ligase UHRF1, Ubiquitin-like PHD and RING finger domain-containing protein 1, NP95, HuNp95, Nuclear protein 95, RNF106, ICBP90, hNp95, UHRF1, Inverted CCAAT box-binding protein of 90 kDa, hUHRF1, Ubiquitin-like-containing PHD and RING finger domains protein 1
Reference ARO-P12419
Note For research use only.
Molecular Constructor
Leu134–Asp366
Product name ARO-P12419-50
Uniprot ID Q96T88
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Molecular weight 29.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu134-Asp366
Aliases /Synonyms Nuclear zinc finger protein Np95, RING-type E3 ubiquitin transferase UHRF1, RING finger protein 106, Transcription factor ICBP90, E3 ubiquitin-protein ligase UHRF1, Ubiquitin-like PHD and RING finger domain-containing protein 1, NP95, HuNp95, Nuclear protein 95, RNF106, ICBP90, hNp95, UHRF1, Inverted CCAAT box-binding protein of 90 kDa, hUHRF1, Ubiquitin-like-containing PHD and RING finger domains protein 1
Reference ARO-P12419
Note For research use only.
Molecular Constructor
Leu134–Asp366

Introduction

Recombinant Human UHRF1 Protein is a highly sought-after protein in the field of molecular biology and biochemistry. This protein is a key player in the regulation of gene expression and has been extensively studied for its role in various cellular processes. In this article, we will delve into the structure, activity, and applications of Recombinant Human UHRF1 Protein.

Structure of Recombinant Human UHRF1 Protein

The UHRF1 protein is a multi-domain protein consisting of 5 distinct domains: the ubiquitin-like domain (UBL), the tandem Tudor domain, the plant homeodomain (PHD) finger, the SET and RING-associated (SRA) domain, and the RING finger domain. The UBL domain is responsible for protein-protein interactions, while the tandem Tudor domain is involved in binding to methylated histones. The PHD finger recognizes and binds to specific DNA sequences, and the SRA domain is responsible for binding to hemimethylated DNA. The RING finger domain has E3 ubiquitin ligase activity, which is essential for the regulation of gene expression.

Activity of Recombinant Human UHRF1 Protein

Recombinant Human UHRF1 Protein plays a crucial role in the epigenetic regulation of gene expression. It acts as a key mediator between DNA methylation and histone modifications, which are crucial for maintaining proper gene expression patterns. The protein binds to hemimethylated DNA and recruits DNA methyltransferases, which add methyl groups to the DNA, leading to gene silencing. Additionally, UHRF1 also interacts with histone modifying enzymes, such as histone deacetylases and histone methyltransferases, to regulate chromatin structure and gene expression. This intricate interplay of UHRF1 with DNA and histone modifications makes it a critical player in the epigenetic regulation of gene expression.

Applications of Recombinant Human UHRF1 Protein

Recombinant Human UHRF1 Protein has a wide range of applications in the field of molecular biology and biochemistry. Here are some of the key applications:

1. Epigenetic Studies

UHRF1 is a key player in the epigenetic regulation of gene expression. Therefore, recombinant UHRF1 protein is widely used in research studies to understand the role of epigenetics in various cellular processes. It is also used to study the mechanisms of gene silencing and activation, which are essential for understanding diseases like cancer.

2. Drug Development

Aberrant UHRF1 activity has been linked to various diseases, including cancer and autoimmune disorders. Therefore, recombinant UHRF1 protein is used in drug development studies to identify potential inhibitors or activators of UHRF1. These inhibitors can be used to target specific diseases by modulating UHRF1 activity.

3. Diagnostic Tool

UHRF1 expression levels have been shown to be altered in various diseases, making it a potential diagnostic marker. Recombinant UHRF1 protein can be used as a diagnostic tool to detect changes in UHRF1 expression levels, which can aid in the early detection and diagnosis of diseases.

4. Protein-Protein Interaction Studies

The UBL domain of UHRF1 is responsible for protein-protein interactions. Therefore, recombinant UHRF1 protein is used in protein-protein interaction studies to identify its binding partners and understand the role of these interactions in various cellular processes.

5. Gene Editing

Recombinant UHRF1 protein has been used in gene editing studies to target specific regions of the genome for DNA methylation or demethylation. This technique, known as epigenome editing, has

Recombinant Human UHRF1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human UHRF1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products