Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human H2AZ1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P0C0S5
Molecular weight:
14.16 kDa

Original price was: €269.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
Ser19–Val128
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human H2AZ1 Protein, N-His

Product name ARO-P11276-100
Uniprot ID P0C0S5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
Molecular weight 14.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser19-Val128
Aliases /Synonyms Histone H2A.Z, H2AZ1, H2AZ, H2A/z, H2AFZ
Reference ARO-P11276
Note For research use only.
Molecular Constructor
Ser19–Val128
Product name ARO-P11276-1MG
Uniprot ID P0C0S5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
Molecular weight 14.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser19-Val128
Aliases /Synonyms Histone H2A.Z, H2AZ1, H2AZ, H2A/z, H2AFZ
Reference ARO-P11276
Note For research use only.
Molecular Constructor
Ser19–Val128
Product name ARO-P11276-50
Uniprot ID P0C0S5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
Molecular weight 14.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser19-Val128
Aliases /Synonyms Histone H2A.Z, H2AZ1, H2AZ, H2A/z, H2AFZ
Reference ARO-P11276
Note For research use only.
Molecular Constructor
Ser19–Val128

Introduction to Recombinant Human H2AZ1 Protein

Recombinant Human H2AZ1 Protein, also known as Histone H2A.Z, is a highly conserved protein that plays a crucial role in regulating chromatin structure and gene expression. It is a variant of the core histone protein H2A, which is responsible for packaging DNA into nucleosomes. The H2AZ1 gene is found in all eukaryotic organisms and encodes for a protein with a molecular weight of approximately 14 kDa.

Structure of Recombinant Human H2AZ1 Protein

The primary structure of Recombinant Human H2AZ1 Protein consists of 128 amino acids and is highly similar to the H2A protein. However, it contains a unique N-terminal tail that is responsible for its distinct functions. The protein is composed of a globular domain, a long helical domain, and a C-terminal tail. The globular domain is responsible for DNA binding, while the long helical domain is involved in protein-protein interactions. The C-terminal tail is responsible for post-translational modifications, such as acetylation and phosphorylation, which play a crucial role in regulating the protein’s activity.

The crystal structure of Recombinant Human H2AZ1 Protein has been determined, revealing its three-dimensional conformation. It forms a dimer with another H2AZ1 protein, forming a tetramer with two H2B proteins. This tetramer then combines with two H3 and two H4 proteins to form the nucleosome core particle, which is the basic unit of chromatin structure.

Activity of Recombinant Human H2AZ1 Protein

Recombinant Human H2AZ1 Protein is involved in various cellular processes, including transcriptional regulation, DNA repair, and genome stability. It is known to be incorporated into chromatin at specific genomic regions, such as promoters and enhancers, where it plays a crucial role in regulating gene expression. It has been shown to facilitate the recruitment of transcription factors and chromatin-modifying enzymes, leading to changes in chromatin structure and gene expression.

Additionally, Recombinant Human H2AZ1 Protein has been found to be involved in DNA repair mechanisms. It is recruited to sites of DNA damage and has been shown to facilitate the repair of double-stranded DNA breaks. This activity is crucial for maintaining genome stability and preventing the development of diseases such as cancer.

Application of Recombinant Human H2AZ1 Protein

The unique properties and functions of Recombinant Human H2AZ1 Protein make it a valuable tool in various research applications. It is commonly used as an antigen in studies involving chromatin structure and gene regulation. Recombinant H2AZ1 protein can be produced in large quantities using recombinant DNA technology, making it easily accessible for research purposes.

Furthermore, Recombinant Human H2AZ1 Protein has been found to be dysregulated in various diseases, including cancer and neurological disorders. This makes it a potential therapeutic target for the development of novel treatments. In addition, its involvement in DNA repair mechanisms makes it a promising candidate for the development of diagnostic tools for DNA damage-related diseases.

Conclusion

In conclusion, Recombinant Human H2AZ1 Protein is a highly conserved protein that plays a crucial role in regulating chromatin structure and gene expression. Its unique structure and functions make it a valuable tool in research and a potential target for therapeutic development. Further studies on this protein may provide a better understanding of its role in various cellular processes and its potential applications in the diagnosis and treatment of diseases.

Recombinant Human H2AZ1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human H2AZ1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products