Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human UCK2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BZX2
Molecular weight:
29.47 kDa

Original price was: €299.00.Current price is: €230.00.

50ug 23% OFF + 230 loyalty points
Phe21–His261
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human UCK2 Protein, N-His

Product name ARO-P11637-100
Uniprot ID Q9BZX2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH
Molecular weight 29.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe21-His261
Aliases /Synonyms Testis-specific protein TSA903, UMPK, Cytidine monophosphokinase 2, Uridine monophosphokinase 2, UCK 2, Uridine-cytidine kinase 2, UCK2
Reference ARO-P11637
Note For research use only.
Molecular Constructor
Phe21–His261
Product name ARO-P11637-1MG
Uniprot ID Q9BZX2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH
Molecular weight 29.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe21-His261
Aliases /Synonyms Testis-specific protein TSA903, UMPK, Cytidine monophosphokinase 2, Uridine monophosphokinase 2, UCK 2, Uridine-cytidine kinase 2, UCK2
Reference ARO-P11637
Note For research use only.
Molecular Constructor
Phe21–His261
Product name ARO-P11637-50
Uniprot ID Q9BZX2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH
Molecular weight 29.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe21-His261
Aliases /Synonyms Testis-specific protein TSA903, UMPK, Cytidine monophosphokinase 2, Uridine monophosphokinase 2, UCK 2, Uridine-cytidine kinase 2, UCK2
Reference ARO-P11637
Note For research use only.
Molecular Constructor
Phe21–His261

Introduction to Recombinant Human UCK2 Protein

Recombinant Human UCK2 Protein is a highly specialized protein that plays a crucial role in cellular metabolism. It is a recombinant form of the human UCK2 protein, which is encoded by the UCK2 gene. This protein is involved in the synthesis of nucleoside triphosphates (NTPs), which are essential for various cellular processes such as DNA replication, RNA transcription, and energy metabolism. In this article, we will discuss the structure, activity, and application of Recombinant Human UCK2 Protein.

Structure of Recombinant Human UCK2 Protein

The human UCK2 gene is located on chromosome 1 and consists of 10 exons. The recombinant form of UCK2 protein is produced by cloning the UCK2 gene into a suitable expression vector and expressing it in a host cell. The resulting protein is a 33 kDa enzyme that contains 305 amino acids. It has a conserved nucleoside kinase domain and a unique N-terminal extension, which is essential for its activity.

The crystal structure of Recombinant Human UCK2 Protein has been determined, revealing its active site and substrate binding pocket. The protein has a dimeric structure, with each monomer containing a nucleoside binding site and a magnesium ion, which is essential for its catalytic activity. The active site of the protein is highly conserved among different species, indicating its crucial role in cellular metabolism.

Activity of Recombinant Human UCK2 Protein

The main function of Recombinant Human UCK2 Protein is to catalyze the conversion of nucleoside monophosphates (NMPs) into nucleoside diphosphates (NDPs) using ATP as a phosphate donor. This reaction is essential for the synthesis of NTPs, which are the building blocks of DNA and RNA. The enzyme has a broad substrate specificity and can phosphorylate a wide range of NMPs, including uridine, cytidine, and thymidine.

Recombinant Human UCK2 Protein is also involved in the regulation of cellular energy metabolism. It has been shown to interact with several key enzymes involved in glycolysis and the tricarboxylic acid (TCA) cycle, suggesting its role in the production of ATP, the energy currency of the cell. Additionally, the enzyme has been found to play a crucial role in the activation of certain antiviral and anticancer drugs, making it a potential target for drug development.

Application of Recombinant Human UCK2 Protein

The unique structure and activity of Recombinant Human UCK2 Protein make it a valuable tool in various research areas. One of its main applications is in the study of nucleotide metabolism and its role in various diseases. Mutations in the UCK2 gene have been linked to several disorders, including mitochondrial diseases and cancer. Recombinant Human UCK2 Protein can be used to study the effects of these mutations on the activity and function of the enzyme.

The enzyme is also used in drug discovery and development, particularly in the field of antiviral and anticancer drugs. Its ability to activate certain drugs, such as 5-fluorouracil, makes it a potential therapeutic target for the treatment of cancer. Additionally, Recombinant Human UCK2 Protein can be used to screen for potential inhibitors of the enzyme, which could be developed into new drugs for the treatment of various diseases.

Conclusion

Recombinant Human UCK2 Protein is a highly specialized enzyme that plays a crucial role in cellular metabolism. Its unique structure and activity make it a valuable tool in various research areas, including nucleotide metabolism and drug discovery. Further studies on this protein could lead to a better understanding of its function and potential therapeutic applications.

Recombinant Human UCK2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human UCK2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products