Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TDGF1/CRIPTO Protein, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P13385
Molecular weight:
17.13 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Leu31–Thr172
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TDGF1/CRIPTO Protein, C-His

Product name ARO-P10309-100
Uniprot ID P13385
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSART
Molecular weight 17.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu31-Thr172
Aliases /Synonyms Cripto-1 growth factor, Teratocarcinoma-derived growth factor 1, TDGF1, CRIPTO, Epidermal growth factor-like cripto protein CR1, CRGF
Reference ARO-P10309
Note For research use only.
Molecular Constructor
Leu31–Thr172
Product name ARO-P10309-1MG
Uniprot ID P13385
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSART
Molecular weight 17.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu31-Thr172
Aliases /Synonyms Cripto-1 growth factor, Teratocarcinoma-derived growth factor 1, TDGF1, CRIPTO, Epidermal growth factor-like cripto protein CR1, CRGF
Reference ARO-P10309
Note For research use only.
Molecular Constructor
Leu31–Thr172
Product name ARO-P10309-50
Uniprot ID P13385
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSART
Molecular weight 17.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu31-Thr172
Aliases /Synonyms Cripto-1 growth factor, Teratocarcinoma-derived growth factor 1, TDGF1, CRIPTO, Epidermal growth factor-like cripto protein CR1, CRGF
Reference ARO-P10309
Note For research use only.
Molecular Constructor
Leu31–Thr172

Recombinant Human TDGF1/CRIPTO Protein: Structure, Activity, and Applications

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, allowing for the production of large quantities of specific proteins with high purity and consistency. One such recombinant protein is the human TDGF1/CRIPTO protein, which has been extensively studied for its structure, activity, and potential applications in various fields.

Structure of Recombinant Human TDGF1/CRIPTO Protein

The human TDGF1/CRIPTO protein, also known as teratocarcinoma-derived growth factor 1 or cripto-1, is a glycoprotein that belongs to the epidermal growth factor (EGF) family. It is encoded by the TDGF1 gene and is composed of 188 amino acids with a molecular weight of 21 kDa. The recombinant form of this protein is produced in various expression systems, such as bacteria, yeast, and mammalian cells, and can be purified to high levels of homogeneity.

The crystal structure of recombinant human TDGF1/CRIPTO protein has been determined, revealing a compact globular structure with three disulfide bonds and a conserved EGF-like domain. The protein also contains a hydrophobic pocket that is believed to be involved in its biological activity.

Activity of Recombinant Human TDGF1/CRIPTO Protein

Recombinant human TDGF1/CRIPTO protein has been shown to have multiple activities, including its role as a growth factor and as a signaling molecule. It binds to its receptor, GRP78, and activates downstream signaling pathways, such as the MAPK/ERK and PI3K/AKT pathways, leading to cell proliferation and survival. It also plays a crucial role in embryonic development, particularly in the formation of the mesoderm and endoderm during gastrulation.

In addition, recombinant human TDGF1/CRIPTO protein has been found to have angiogenic properties, promoting the growth of new blood vessels. It also has a role in tumor growth and progression, as it is overexpressed in various types of cancers and has been linked to increased cell proliferation, invasion, and metastasis.

Applications of Recombinant Human TDGF1/CRIPTO Protein

The unique structure and activity of recombinant human TDGF1/CRIPTO protein make it a promising candidate for various applications in the fields of medicine and biotechnology.

One potential application is in tissue engineering and regenerative medicine. The protein has been shown to promote the differentiation of stem cells into various cell types, including cardiomyocytes and neurons. This makes it a potential therapeutic agent for repairing damaged tissues and organs.

Recombinant human TDGF1/CRIPTO protein also has potential applications in cancer therapy. Its overexpression in many types of cancers makes it a potential target for cancer treatment. In addition, its angiogenic properties can be harnessed to develop anti-angiogenic therapies for cancer.

Furthermore, recombinant human TDGF1/CRIPTO protein has been studied for its role in pregnancy and reproductive health. It has been found to play a crucial role in placental development and has been linked to pregnancy complications, such as preeclampsia. Understanding its role in these conditions could lead to the development of new diagnostic and therapeutic approaches.

Conclusion

In conclusion, recombinant human TDGF1/CRIPTO protein is a unique and versatile protein with a compact structure and multiple activities. Its potential applications in tissue engineering, cancer therapy, and reproductive health make it a promising candidate for further research and development. With advancements in recombinant protein production and purification techniques, the use of recombinant human TDGF1/CRIPTO protein in various fields is expected to increase in the future.

Recombinant Human TDGF1/CRIPTO Protein, C-His

There are no reviews yet.

Be the first to review “Recombinant Human TDGF1/CRIPTO Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products