Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TACR2 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P21452
Molecular weight:
18.75 kDa

Original price was: €237.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Asn311–Ser366
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TACR2 Protein, N-His-SUMO

Product name ARO-P11369-100
Uniprot ID P21452
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPS
Molecular weight 18.75 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn311-Ser366
Aliases /Synonyms NK-2 receptor, NKNAR, Neurokinin A receptor, SKR, Tachykinin receptor 2, TACR2, TAC2R, Substance-K receptor, NK2R, NK-2R
Reference ARO-P11369
Note For research use only.
Molecular Constructor
Asn311–Ser366
Product name ARO-P11369-1MG
Uniprot ID P21452
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPS
Molecular weight 18.75 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn311-Ser366
Aliases /Synonyms NK-2 receptor, NKNAR, Neurokinin A receptor, SKR, Tachykinin receptor 2, TACR2, TAC2R, Substance-K receptor, NK2R, NK-2R
Reference ARO-P11369
Note For research use only.
Molecular Constructor
Asn311–Ser366
Product name ARO-P11369-50
Uniprot ID P21452
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPS
Molecular weight 18.75 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn311-Ser366
Aliases /Synonyms NK-2 receptor, NKNAR, Neurokinin A receptor, SKR, Tachykinin receptor 2, TACR2, TAC2R, Substance-K receptor, NK2R, NK-2R
Reference ARO-P11369
Note For research use only.
Molecular Constructor
Asn311–Ser366

Structure of Recombinant Human TACR2 Protein

The Recombinant Human TACR2 Protein is a synthetic version of the human TACR2 protein, also known as the neurokinin 2 receptor (NK2R). It is produced through recombinant DNA technology, where the gene encoding for TACR2 is inserted into a host cell, such as bacteria or yeast, and then expressed to produce the protein.

The protein has a molecular weight of approximately 46 kDa and is composed of 407 amino acids. It has a characteristic seven-transmembrane domain structure, which is common among G protein-coupled receptors (GPCRs). TACR2 also has an extracellular N-terminal domain and an intracellular C-terminal domain.

Activity of Recombinant Human TACR2 Protein

The main function of TACR2 is to bind to the neuropeptide substance P and mediate its effects, such as neurogenic inflammation, smooth muscle contraction, and pain perception. As a GPCR, TACR2 activates intracellular signaling pathways upon ligand binding.

Studies have shown that the recombinant TACR2 protein has similar activity to the natural form, with the ability to bind to substance P and activate downstream signaling pathways. This makes it a valuable tool for studying the role of TACR2 in various physiological and pathological processes.

Application of Recombinant Human TACR2 Protein

The recombinant TACR2 protein has a wide range of applications in both research and therapeutic settings. Here are some of its main uses:

  • Drug Development: TACR2 is a potential target for the treatment of various diseases, including chronic pain, inflammation, and cancer. The recombinant protein can be used to screen and identify potential drug candidates that can modulate TACR2 activity.
  • Neuroscience Research: TACR2 is highly expressed in the central and peripheral nervous systems, making it a key player in various neurological processes. The recombinant protein can be used to study the role of TACR2 in neuronal development, pain perception, and other neurological disorders.
  • Disease Diagnosis: TACR2 has been implicated in several diseases, and its expression levels have been linked to disease severity. The recombinant protein can be used as an antigen in diagnostic tests to detect TACR2 levels in patient samples and aid in disease diagnosis and monitoring.
  • Cell Signaling Studies: TACR2 is a GPCR that activates intracellular signaling pathways upon ligand binding. The recombinant protein can be used to study the downstream signaling events and pathways activated by TACR2, providing valuable insights into its role in various cellular processes.

Conclusion

The Recombinant Human TACR2 Protein is a synthetic version of the human TACR2 protein, produced through recombinant DNA technology. It has a similar structure and activity to the natural form and has a wide range of applications in research and therapeutics. Its ability to bind to substance P and activate downstream signaling pathways makes it a valuable tool for studying the role of TACR2 in various physiological and pathological processes.

Recombinant Human TACR2 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human TACR2 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products