Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLC17A1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14916
Molecular weight:
18.13 kDa

Original price was: €216.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Ala211–Ser261
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLC17A1 Protein, N-His-SUMO

Product name ARO-P11948-100
Uniprot ID Q14916
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVCLLWFVLFYDDPKDHPCISISEKEYITSSLVQQVSSSRQSLPIKAILKS
Molecular weight 18.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala211-Ser261
Aliases /Synonyms NPT1, Renal sodium-phosphate transport protein 1, Renal sodium-dependent phosphate transport protein 1, Sodium-dependent phosphate transport protein 1, Renal Na(+)-dependent phosphate cotransporter 1, Sodium/phosphate cotransporter 1, Na(+)/PI cotransporter 1, Solute carrier family 17 member 1, Na/Pi-4, SLC17A1
Reference ARO-P11948
Note For research use only.
Molecular Constructor
Ala211–Ser261
Product name ARO-P11948-1MG
Uniprot ID Q14916
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVCLLWFVLFYDDPKDHPCISISEKEYITSSLVQQVSSSRQSLPIKAILKS
Molecular weight 18.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala211-Ser261
Aliases /Synonyms NPT1, Renal sodium-phosphate transport protein 1, Renal sodium-dependent phosphate transport protein 1, Sodium-dependent phosphate transport protein 1, Renal Na(+)-dependent phosphate cotransporter 1, Sodium/phosphate cotransporter 1, Na(+)/PI cotransporter 1, Solute carrier family 17 member 1, Na/Pi-4, SLC17A1
Reference ARO-P11948
Note For research use only.
Molecular Constructor
Ala211–Ser261
Product name ARO-P11948-50
Uniprot ID Q14916
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVCLLWFVLFYDDPKDHPCISISEKEYITSSLVQQVSSSRQSLPIKAILKS
Molecular weight 18.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala211-Ser261
Aliases /Synonyms NPT1, Renal sodium-phosphate transport protein 1, Renal sodium-dependent phosphate transport protein 1, Sodium-dependent phosphate transport protein 1, Renal Na(+)-dependent phosphate cotransporter 1, Sodium/phosphate cotransporter 1, Na(+)/PI cotransporter 1, Solute carrier family 17 member 1, Na/Pi-4, SLC17A1
Reference ARO-P11948
Note For research use only.
Molecular Constructor
Ala211–Ser261

Recombinant Human SLC17A1 Protein: Structure, Activity, and Application

Introduction

The SLC17A1 protein, also known as the solute carrier family 17 member 1, is a transmembrane protein that belongs to the SLC17 family. This protein is encoded by the SLC17A1 gene and is primarily expressed in the brain, liver, and kidneys. It plays a crucial role in the transport of small molecules, such as nucleotides and nucleosides, across the cell membrane. In recent years, recombinant human SLC17A1 protein has gained significant attention in the field of biotechnology and medicine due to its potential therapeutic applications. In this article, we will discuss the structure, activity, and application of recombinant human SLC17A1 protein.

Structure of Recombinant Human SLC17A1 Protein

The human SLC17A1 protein is composed of 417 amino acids and has a molecular weight of approximately 45 kDa. It consists of 12 transmembrane domains with both the N- and C-termini located on the cytoplasmic side of the cell membrane. The protein also contains a large extracellular loop between transmembrane domains 5 and 6, which is responsible for substrate binding and transport. The structure of recombinant human SLC17A1 protein is similar to its native form, making it a reliable tool for studying the function and activity of this protein.

Activity of Recombinant Human SLC17A1 Protein

The primary function of SLC17A1 protein is to transport small molecules, such as nucleotides and nucleosides, across the cell membrane. This transport is facilitated by a sodium-dependent mechanism, where the influx of sodium ions drives the transport of substrates against their concentration gradient. Recombinant human SLC17A1 protein has been extensively studied for its activity in transporting various nucleotides and nucleosides, including adenosine, uridine, and guanosine. This activity has important implications in the regulation of cellular processes, such as energy metabolism and cell signaling.

Application of Recombinant Human SLC17A1 Protein

The unique transport activity of SLC17A1 protein makes it a promising candidate for therapeutic applications. Recombinant human SLC17A1 protein has been used in various studies to investigate its potential in treating diseases, such as cancer and neurological disorders. One of the major applications of this protein is in drug delivery systems, where it can be used to transport therapeutic nucleotides and nucleosides across the blood-brain barrier. This has the potential to improve the efficacy and specificity of drugs for treating brain tumors and other neurological diseases.

Moreover, recombinant human SLC17A1 protein has also been studied for its role in regulating immune responses. It has been shown to play a crucial role in the activation and proliferation of T cells, which are important components of the immune system. This opens up the possibility of using this protein in immunotherapy for treating autoimmune diseases and cancer.

Additionally, recombinant human SLC17A1 protein has been used in diagnostic assays for detecting specific antigens. The protein can be used as a target for antibodies, which can then be detected using various techniques, such as ELISA and western blotting. This has potential applications in the diagnosis of infectious diseases and cancer.

Conclusion

In summary, recombinant human SLC17A1 protein is a transmembrane protein with important functions in transporting nucleotides and nucleosides across the cell membrane. Its structure and activity make it a valuable tool for studying the function and potential therapeutic applications of this protein. With ongoing research, the use of recombinant human SLC17A1 protein is likely to expand, leading to new and innovative treatments for various diseases.

Recombinant Human SLC17A1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human SLC17A1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products