Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PLEKHO1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q53GL0
Molecular weight:
16.40 kDa

Original price was: €253.00.Current price is: €230.00.

50ug 9% OFF + 230 loyalty points
Glu23–Thr143
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PLEKHO1 Protein, N-His

Product name ARO-P11943-100
Uniprot ID Q53GL0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEVKDEKNIQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEKESWINALNSAITRAKNRILDEVT
Molecular weight 16.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu23-Thr143
Aliases /Synonyms PH domain-containing family O member 1, CK2-interacting protein 1, Osteoclast maturation-associated gene 120 protein, OC120, JBP, Casein kinase 2-interacting protein 1, C-Jun-binding protein, CKIP1, PLEKHO1, CKIP-1, Pleckstrin homology domain-containing family O member 1
Reference ARO-P11943
Note For research use only.
Molecular Constructor
Glu23–Thr143
Product name ARO-P11943-1MG
Uniprot ID Q53GL0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEVKDEKNIQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEKESWINALNSAITRAKNRILDEVT
Molecular weight 16.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu23-Thr143
Aliases /Synonyms PH domain-containing family O member 1, CK2-interacting protein 1, Osteoclast maturation-associated gene 120 protein, OC120, JBP, Casein kinase 2-interacting protein 1, C-Jun-binding protein, CKIP1, PLEKHO1, CKIP-1, Pleckstrin homology domain-containing family O member 1
Reference ARO-P11943
Note For research use only.
Molecular Constructor
Glu23–Thr143
Product name ARO-P11943-50
Uniprot ID Q53GL0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEVKDEKNIQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEKESWINALNSAITRAKNRILDEVT
Molecular weight 16.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu23-Thr143
Aliases /Synonyms PH domain-containing family O member 1, CK2-interacting protein 1, Osteoclast maturation-associated gene 120 protein, OC120, JBP, Casein kinase 2-interacting protein 1, C-Jun-binding protein, CKIP1, PLEKHO1, CKIP-1, Pleckstrin homology domain-containing family O member 1
Reference ARO-P11943
Note For research use only.
Molecular Constructor
Glu23–Thr143

Introduction

Recombinant Human PLEKHO1 Protein, also known as Pleckstrin Homology Domain Containing O1, is a protein that plays a crucial role in various cellular processes such as cell proliferation, migration, and survival. This protein is encoded by the PLEKHO1 gene and is expressed in various tissues, including the brain, heart, and liver.

Structure of Recombinant Human PLEKHO1 Protein

The Recombinant Human PLEKHO1 Protein is a 40 kDa protein consisting of 349 amino acids. It contains a Pleckstrin Homology (PH) domain, a C2 domain, and a proline-rich region. The PH domain is responsible for binding to phospholipids, while the C2 domain is involved in protein-protein interactions. The proline-rich region is essential for the recruitment of signaling molecules.

Activity of Recombinant Human PLEKHO1 Protein

The main activity of Recombinant Human PLEKHO1 Protein is its role in regulating cell proliferation and survival. It has been shown to interact with various signaling molecules, including Akt, ERK, and PI3K, to promote cell growth and survival. It also plays a crucial role in cell migration by regulating the activity of focal adhesion kinase (FAK) and paxillin.

Moreover, Recombinant Human PLEKHO1 Protein has been shown to regulate the activity of the mammalian target of rapamycin (mTOR) pathway, which is involved in protein synthesis and cell growth. It also plays a role in autophagy, a process that helps in the removal of damaged or unnecessary cellular components.

Application of Recombinant Human PLEKHO1 Protein

Due to its crucial role in cell proliferation, migration, and survival, Recombinant Human PLEKHO1 Protein has been extensively studied in various diseases. It has been shown to be upregulated in various types of cancer, including breast, colon, and lung cancer, and is associated with tumor growth and metastasis. Therefore, it has been proposed as a potential therapeutic target for cancer treatment.

Additionally, Recombinant Human PLEKHO1 Protein has been studied in cardiovascular diseases, as it is highly expressed in the heart and plays a role in regulating cardiac function. It has been shown to be involved in the development of cardiac hypertrophy, a condition characterized by an increase in heart size and thickness, and is associated with heart failure. Therefore, targeting this protein may have therapeutic potential in treating cardiovascular diseases.

Furthermore, Recombinant Human PLEKHO1 Protein has been studied in neurological disorders such as Alzheimer’s disease and Parkinson’s disease. It has been shown to be involved in the regulation of neuronal survival and function, and its dysregulation has been linked to the development of these diseases. Therefore, targeting this protein may have therapeutic potential in treating these neurological disorders.

Conclusion

Recombinant Human PLEKHO1 Protein is a crucial protein involved in various cellular processes, including cell proliferation, migration, and survival. Its structure, activity, and role in various diseases make it a potential therapeutic target for cancer, cardiovascular diseases, and neurological disorders. Further research on this protein may provide valuable insights into its potential as a therapeutic target and aid in the development of novel treatments for these diseases.

Recombinant Human PLEKHO1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PLEKHO1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products