Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SUOX Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P51687
Molecular weight:
43.46 kDa

Original price was: €232.00.Current price is: €193.00.

50ug 17% OFF + 193 loyalty points
Val166–Pro545
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SUOX Protein, N-His

Product name ARO-P10393-100
Uniprot ID P51687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSP
Molecular weight 43.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val166-Pro545
Aliases /Synonyms Sulfite oxidase, mitochondrial, SUOX
Reference ARO-P10393
Note For research use only.
Molecular Constructor
Val166–Pro545
Product name ARO-P10393-1MG
Uniprot ID P51687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSP
Molecular weight 43.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val166-Pro545
Aliases /Synonyms Sulfite oxidase, mitochondrial, SUOX
Reference ARO-P10393
Note For research use only.
Molecular Constructor
Val166–Pro545
Product name ARO-P10393-50
Uniprot ID P51687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSP
Molecular weight 43.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val166-Pro545
Aliases /Synonyms Sulfite oxidase, mitochondrial, SUOX
Reference ARO-P10393
Note For research use only.
Molecular Constructor
Val166–Pro545

Introduction to Recombinant Human SUOX Protein

Recombinant human SUOX protein is a highly purified form of the human enzyme sulfite oxidase (SUOX) that has been produced using recombinant DNA technology. This protein plays a crucial role in the body’s natural detoxification process, converting toxic sulfite into a harmless sulfate compound. In this article, we will explore the structure, activity, and applications of recombinant human SUOX protein.

Structure of Recombinant Human SUOX Protein

The recombinant human SUOX protein is a homodimer, meaning it is composed of two identical subunits. Each subunit consists of 587 amino acids and has a molecular weight of approximately 65 kDa. The protein has a globular structure with a central core of beta sheets surrounded by alpha helices. This unique structure allows the protein to efficiently bind and convert sulfite molecules.

The gene for human SUOX protein is located on chromosome 12 and encodes for a precursor protein that undergoes several post-translational modifications to form the mature enzyme. Recombinant DNA technology has allowed for the production of this protein in large quantities, making it a valuable tool for research and medical applications.

Activity of Recombinant Human SUOX Protein

The main function of recombinant human SUOX protein is to catalyze the oxidation of sulfite to sulfate in the presence of oxygen. This reaction is essential for the body’s natural detoxification process, as sulfite is a toxic byproduct of sulfur-containing amino acid metabolism. Without the activity of SUOX protein, sulfite can accumulate in the body and cause severe neurological and developmental problems.

Recombinant human SUOX protein has been shown to have high enzymatic activity, with a specific activity of 1.5 units/mg. This activity is comparable to that of the natural SUOX protein found in the body. The protein also has a high affinity for sulfite, making it an efficient catalyst for the conversion of this toxic compound.

Applications of Recombinant Human SUOX Protein

The production of recombinant human SUOX protein has opened up many possibilities for research and medical applications. One of the main uses of this protein is in the development of diagnostic tests for inherited disorders that affect the activity of SUOX protein. These tests can help identify individuals with a deficiency in SUOX protein, allowing for early detection and treatment of these disorders.

Recombinant human SUOX protein has also been used in studies to understand the role of SUOX in various diseases and conditions. For example, researchers have found that mutations in the SUOX gene can lead to the development of neurological disorders such as isolated sulfite oxidase deficiency and molybdenum cofactor deficiency. By studying the activity of recombinant human SUOX protein, scientists can gain a better understanding of these diseases and potentially develop new treatments.

Furthermore, recombinant human SUOX protein has potential therapeutic applications. Studies have shown that the administration of this protein can help reduce the levels of sulfite in the body, which can be beneficial for individuals with sulfite sensitivity or those with conditions that cause high levels of sulfite, such as asthma. The protein has also been investigated as a potential treatment for sulfite toxicity in cases of accidental ingestion or exposure.

Conclusion

In summary, recombinant human SUOX protein is a valuable tool for research and medical applications. Its unique structure and high enzymatic activity make it an efficient catalyst for the conversion of toxic sulfite to sulfate. The production of this protein using recombinant DNA technology has allowed for a better understanding of its role in various diseases and has potential therapeutic applications. Further research on this protein may lead to new treatments for sulfite-related disorders and conditions.

Recombinant Human SUOX Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SUOX Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products