Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human COX4I2 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96KJ9
Molecular weight:
17.78 kDa

Original price was: €255.00.Current price is: €230.00.

50ug 10% OFF + 230 loyalty points
Thr55–Asn100
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human COX4I2 Protein, N-His-SUMO

Product name ARO-P11406-100
Uniprot ID Q96KJ9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSN
Molecular weight 17.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr55-Asn100
Aliases /Synonyms COX IV-2, Cytochrome c oxidase subunit 4 isoform 2, mitochondrial, COX4I2, Cytochrome c oxidase subunit IV isoform 2, COX4L2
Reference ARO-P11406
Note For research use only.
Molecular Constructor
Thr55–Asn100
Product name ARO-P11406-1MG
Uniprot ID Q96KJ9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSN
Molecular weight 17.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr55-Asn100
Aliases /Synonyms COX IV-2, Cytochrome c oxidase subunit 4 isoform 2, mitochondrial, COX4I2, Cytochrome c oxidase subunit IV isoform 2, COX4L2
Reference ARO-P11406
Note For research use only.
Molecular Constructor
Thr55–Asn100
Product name ARO-P11406-50
Uniprot ID Q96KJ9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSN
Molecular weight 17.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr55-Asn100
Aliases /Synonyms COX IV-2, Cytochrome c oxidase subunit 4 isoform 2, mitochondrial, COX4I2, Cytochrome c oxidase subunit IV isoform 2, COX4L2
Reference ARO-P11406
Note For research use only.
Molecular Constructor
Thr55–Asn100

Introduction to Recombinant Human COX4I2 Protein

Recombinant Human COX4I2 Protein, also known as cytochrome c oxidase subunit 4 isoform 2, is a protein that plays a crucial role in the electron transport chain and oxidative phosphorylation. It is encoded by the COX4I2 gene and is a member of the cytochrome c oxidase (COX) family. This protein is highly conserved across species and is essential for the proper functioning of mitochondria, the powerhouses of the cell.

Structure of Recombinant Human COX4I2 Protein

The primary structure of Recombinant Human COX4I2 Protein consists of 167 amino acids, with a molecular weight of approximately 18.9 kDa. It has a single transmembrane domain and is located in the inner mitochondrial membrane. The protein has a highly conserved heme-binding motif that is crucial for its function in the electron transport chain. Recombinant Human COX4I2 Protein also contains two cysteine residues that are involved in the formation of disulfide bonds, contributing to the stability of the protein.

At the secondary structure level, Recombinant Human COX4I2 Protein is composed of alpha-helices and beta-sheets, which are arranged in a characteristic fold. The tertiary structure of the protein is essential for its proper functioning and is maintained by various interactions between amino acid residues.

Activity of Recombinant Human COX4I2 Protein

Recombinant Human COX4I2 Protein is a subunit of the cytochrome c oxidase complex, which is responsible for the final step in the electron transport chain. It plays a crucial role in the transfer of electrons from cytochrome c to oxygen, resulting in the production of ATP, the energy currency of the cell. This protein is essential for the proper functioning of mitochondria and the overall energy metabolism of the cell.

In addition to its role in the electron transport chain, Recombinant Human COX4I2 Protein has been shown to have antioxidant properties. It has been reported to protect cells from oxidative stress and prevent cell death. This activity is thought to be due to the heme-binding motif of the protein, which can scavenge free radicals and prevent damage to cellular components.

Application of Recombinant Human COX4I2 Protein

Recombinant Human COX4I2 Protein has various applications in both research and medical fields. It is commonly used as an antigen in studies related to mitochondrial function and energy metabolism. The protein can be used to generate specific antibodies that can be used for various techniques, such as Western blotting and immunohistochemistry.

In the medical field, Recombinant Human COX4I2 Protein has been linked to various diseases, including neurodegenerative disorders and cancer. Mutations in the COX4I2 gene have been associated with Leigh syndrome, a severe neurological disorder, and have also been found in some cases of breast cancer. Moreover, studies have shown that dysregulation of COX4I2 expression can lead to altered mitochondrial function, which is a common feature in many diseases.

Recombinant Human COX4I2 Protein has also been explored as a potential therapeutic target. In cancer, targeting this protein has been suggested as a strategy to disrupt the energy metabolism of cancer cells, leading to their death. In addition, the antioxidant properties of the protein make it a potential target for the treatment of oxidative stress-related diseases.

Conclusion

Recombinant Human COX4I2 Protein is a crucial component of the cytochrome c oxidase complex and plays a vital role in mitochondrial function and energy metabolism. Its structure, activity, and various applications make it a valuable protein for both research and medical purposes. Further studies on this protein

Recombinant Human COX4I2 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human COX4I2 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products