Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human E2F4 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q16254
Molecular weight:
35.76 kDa

Original price was: €243.00.Current price is: €193.00.

50ug 21% OFF + 193 loyalty points
Ser16–Lys82
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human E2F4 Protein, N-GST & C-His

Product name ARO-P11359-100
Uniprot ID Q16254
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWK
Molecular weight 35.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser16-Lys82
Aliases /Synonyms E2F4, Transcription factor E2F4, E2F-4
Reference ARO-P11359
Note For research use only.
Molecular Constructor
Ser16–Lys82
Product name ARO-P11359-1MG
Uniprot ID Q16254
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWK
Molecular weight 35.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser16-Lys82
Aliases /Synonyms E2F4, Transcription factor E2F4, E2F-4
Reference ARO-P11359
Note For research use only.
Molecular Constructor
Ser16–Lys82
Product name ARO-P11359-50
Uniprot ID Q16254
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWK
Molecular weight 35.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser16-Lys82
Aliases /Synonyms E2F4, Transcription factor E2F4, E2F-4
Reference ARO-P11359
Note For research use only.
Molecular Constructor
Ser16–Lys82

Introduction to Recombinant Human E2F4 Protein

Recombinant Human E2F4 Protein is a key transcription factor that plays a crucial role in cell cycle regulation and cell proliferation. This protein is encoded by the E2F4 gene and belongs to the E2F family of transcription factors. It is a highly conserved protein found in both humans and other mammals, and is essential for normal cell growth and development.

Structure of Recombinant Human E2F4 Protein

The recombinant human E2F4 protein is a 414 amino acid long polypeptide with a molecular weight of approximately 47 kDa. It consists of several structural domains, including an N-terminal DNA binding domain, a dimerization domain, and a C-terminal transactivation domain. The DNA binding domain allows the protein to bind to specific DNA sequences, while the dimerization domain enables it to form complexes with other proteins. The transactivation domain is responsible for activating the expression of target genes.

Activity of Recombinant Human E2F4 Protein

The main function of recombinant human E2F4 protein is to regulate the expression of genes involved in cell cycle progression. It does this by binding to specific DNA sequences and either activating or repressing the transcription of target genes. E2F4 is known to interact with other proteins, such as retinoblastoma protein (pRB), to control the activity of cell cycle genes. This protein is also involved in the regulation of apoptosis, differentiation, and DNA repair.

Application of Recombinant Human E2F4 Protein

Recombinant human E2F4 protein has a wide range of applications in both research and therapeutic settings. One of its main uses is in studying the cell cycle and its regulation. Researchers can use this protein to investigate the role of E2F4 in cell proliferation and differentiation, as well as its interactions with other proteins involved in these processes.

Furthermore, recombinant human E2F4 protein has potential therapeutic applications in cancer treatment. Abnormal expression of E2F4 has been linked to various types of cancer, including breast, lung, and bladder cancer. By targeting E2F4, researchers hope to develop new treatments that can inhibit cancer cell growth and induce cell death.

Recombinant human E2F4 protein can also be used as an antigen in vaccine development. It has been shown to induce a strong immune response and can be used to develop vaccines against viral infections or cancer. Additionally, this protein can be used in diagnostic tests to detect the presence of E2F4 in patient samples, which can aid in the early detection and treatment of diseases.

Conclusion

In conclusion, recombinant human E2F4 protein is a crucial transcription factor involved in cell cycle regulation and cell proliferation. Its structure, activity, and applications make it a valuable tool in both research and therapeutic settings. By understanding the role of E2F4 in normal and disease processes, we can further advance our knowledge and develop new treatments for various diseases.

Recombinant Human E2F4 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human E2F4 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products