Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human STING1/TMEM173, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86WV6
Molecular weight:
29.39 kDa

Original price was: €271.00.Current price is: €230.00.

50ug 15% OFF + 230 loyalty points
Leu139–Ser379
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human STING1/TMEM173, N-His

Product name ARO-P13268-100
Uniprot ID Q86WV6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
Molecular weight 29.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu139-Ser379
Aliases /Synonyms STING1, Stimulator of interferon genes protein, Endoplasmic reticulum interferon stimulator, Transmembrane protein 173, ERIS, hSTING, TMEM173, Mediator of IRF3 activation, MITA, hMITA
Reference ARO-P13268
Note For research use only.
Molecular Constructor
Leu139–Ser379
Product name ARO-P13268-1MG
Uniprot ID Q86WV6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
Molecular weight 29.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu139-Ser379
Aliases /Synonyms STING1, Stimulator of interferon genes protein, Endoplasmic reticulum interferon stimulator, Transmembrane protein 173, ERIS, hSTING, TMEM173, Mediator of IRF3 activation, MITA, hMITA
Reference ARO-P13268
Note For research use only.
Molecular Constructor
Leu139–Ser379
Product name ARO-P13268-50
Uniprot ID Q86WV6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
Molecular weight 29.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu139-Ser379
Aliases /Synonyms STING1, Stimulator of interferon genes protein, Endoplasmic reticulum interferon stimulator, Transmembrane protein 173, ERIS, hSTING, TMEM173, Mediator of IRF3 activation, MITA, hMITA
Reference ARO-P13268
Note For research use only.
Molecular Constructor
Leu139–Ser379

Introduction to Recombinant Human STING1/TMEM173

Recombinant Human STING1/TMEM173, also known as stimulator of interferon genes 1/transmembrane protein 173, is a protein that plays a crucial role in the innate immune response. It is a member of the STING family of proteins and is encoded by the TMEM173 gene. STING1/TMEM173 is involved in the detection of viral and bacterial infections and is a key player in the activation of the immune system. In this article, we will explore the structure, activity, and applications of this important protein.

Structure of Recombinant Human STING1/TMEM173

Recombinant Human STING1/TMEM173 is a 379 amino acid protein with a molecular weight of 42 kDa. It is composed of three domains: an N-terminal transmembrane domain, a central cytoplasmic domain, and a C-terminal domain. The transmembrane domain anchors the protein to the endoplasmic reticulum, while the cytoplasmic domain is responsible for its signaling activity. The C-terminal domain contains a conserved sequence known as the STING domain, which is essential for its function.

Activity of Recombinant Human STING1/TMEM173

STING1/TMEM173 is primarily involved in the detection of cytosolic DNA, which can be a sign of viral or bacterial infection. Upon binding to DNA, STING1/TMEM173 undergoes a conformational change, leading to the recruitment and activation of downstream signaling molecules. This results in the production of type I interferons and pro-inflammatory cytokines, which are essential for the activation of the immune system.

In addition to its role in detecting DNA, STING1/TMEM173 also plays a role in the regulation of autophagy, a process that helps in the elimination of intracellular pathogens. It has also been shown to be involved in the activation of natural killer cells and the production of reactive oxygen species, which are important for killing infected cells.

Applications of Recombinant Human STING1/TMEM173

Recombinant Human STING1/TMEM173 has numerous applications in both research and clinical settings. One of its main uses is in the study of innate immunity and its role in the immune response to infections. It is also a valuable tool for understanding the mechanisms of autophagy and its regulation.

In the clinic, STING1/TMEM173 has been identified as a potential target for the development of novel immunotherapies for cancer. It has been shown to enhance the anti-tumor immune response and has been used in combination with other therapies to improve their efficacy. Additionally, STING1/TMEM173 has been studied for its potential as a biomarker for certain autoimmune diseases, such as lupus and psoriasis.

Recombinant Human STING1/TMEM173 as an Antigen

Recombinant Human STING1/TMEM173 is also commonly used as an antigen in vaccine development. Its ability to activate the immune system and induce the production of antibodies makes it a promising candidate for the development of vaccines against viral and bacterial infections. Furthermore, its role in the regulation of autophagy makes it a potential target for the development of vaccines against diseases caused by intracellular pathogens.

Conclusion

In summary, Recombinant Human STING1/TMEM173 is a vital protein involved in the innate immune response. Its structure, activity, and applications make it a crucial player in the fight against infections and diseases. As research on this protein continues, we can expect to uncover more of its roles and potential therapeutic applications.

Recombinant Human STING1/TMEM173, N-His

There are no reviews yet.

Be the first to review “Recombinant Human STING1/TMEM173, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products