Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SS18L1 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O75177
Molecular weight:
35.07 kDa

Original price was: €358.00.Current price is: €275.00.

100ug 23% OFF + 275 loyalty points
Thr17–Leu75
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SS18L1 Protein, N-GST & C-His

Product name ARO-P11362-100
Uniprot ID O75177
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TQQTIQKMLDENHHLIQCILEYQSKGKTAECTQYQQILHRNLVYLATIADSNQNMQSLL
Molecular weight 35.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr17-Leu75
Aliases /Synonyms Calcium-responsive transactivator, CREST, SS18-like protein 1, KIAA0693, SS18L1, SYT homolog 1
Reference ARO-P11362
Note For research use only.
Molecular Constructor
Thr17–Leu75
Product name ARO-P11362-1MG
Uniprot ID O75177
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TQQTIQKMLDENHHLIQCILEYQSKGKTAECTQYQQILHRNLVYLATIADSNQNMQSLL
Molecular weight 35.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr17-Leu75
Aliases /Synonyms Calcium-responsive transactivator, CREST, SS18-like protein 1, KIAA0693, SS18L1, SYT homolog 1
Reference ARO-P11362
Note For research use only.
Molecular Constructor
Thr17–Leu75
Product name ARO-P11362-50
Uniprot ID O75177
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TQQTIQKMLDENHHLIQCILEYQSKGKTAECTQYQQILHRNLVYLATIADSNQNMQSLL
Molecular weight 35.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr17-Leu75
Aliases /Synonyms Calcium-responsive transactivator, CREST, SS18-like protein 1, KIAA0693, SS18L1, SYT homolog 1
Reference ARO-P11362
Note For research use only.
Molecular Constructor
Thr17–Leu75

Introduction

The Recombinant Human SS18L1 Protein is a highly purified and biologically active protein that is produced through recombinant DNA technology. It is a member of the SS18 family of proteins and is encoded by the SS18L1 gene. This protein plays a crucial role in various cellular processes, making it a valuable tool for scientific research and potential therapeutic applications.

Structure of Recombinant Human SS18L1 Protein

The Recombinant Human SS18L1 Protein is a 98 kDa protein consisting of 888 amino acids. It contains a conserved SNH domain, which is characteristic of the SS18 family of proteins. This domain is responsible for the protein’s ability to interact with other proteins and play a role in various cellular processes.

The protein is produced in a mammalian expression system, ensuring proper folding and post-translational modifications, such as glycosylation, that are essential for its biological activity. The recombinant protein is purified using advanced chromatography techniques, resulting in a highly pure and stable product.

Activity of Recombinant Human SS18L1 Protein

The Recombinant Human SS18L1 Protein is a transcriptional regulator that plays a critical role in chromatin remodeling and gene expression. It interacts with other proteins, such as the SWI/SNF chromatin remodeling complex, to regulate the expression of various genes involved in cell growth, differentiation, and development.

Studies have shown that SS18L1 is highly expressed in embryonic stem cells and is essential for maintaining their pluripotency and self-renewal capabilities. It has also been implicated in the development of various tissues and organs, including the brain, heart, and skeletal muscle.

Furthermore, the Recombinant Human SS18L1 Protein has been shown to play a role in cancer development. It is overexpressed in certain types of cancers, such as synovial sarcoma, and has been linked to tumor growth and metastasis. Therefore, understanding the activity of this protein can provide valuable insights into the mechanisms of cancer development and may lead to the development of new therapeutic strategies.

Application of Recombinant Human SS18L1 Protein

The Recombinant Human SS18L1 Protein has a wide range of applications in scientific research. It can be used as an antigen for the production of specific antibodies to study the protein’s expression, localization, and function in different cell types and tissues.

The protein can also be used in biochemical assays to study its interactions with other proteins and its role in chromatin remodeling and gene expression. This can provide valuable information about the protein’s activity and its involvement in various cellular processes.

Moreover, the Recombinant Human SS18L1 Protein has potential therapeutic applications. Due to its role in cancer development, it is being investigated as a potential target for cancer treatment. Inhibitors of SS18L1 have shown promising results in pre-clinical studies, and further research is being conducted to develop more effective and specific inhibitors for clinical use.

Conclusion

The Recombinant Human SS18L1 Protein is a highly valuable tool for scientific research and has potential therapeutic applications. Its well-defined structure, activity, and various applications make it a crucial protein in understanding cellular processes and developing new treatments for diseases, particularly cancer. With ongoing research and advancements in recombinant DNA technology, the potential of this protein in both basic and applied science is vast and promising.

Recombinant Human SS18L1 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human SS18L1 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products