Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SNRPA1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P09661
Molecular weight:
22.33 kDa

Original price was: €251.00.Current price is: €193.00.

50ug 23% OFF + 193 loyalty points
Met1–Arg176
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SNRPA1 Protein, N-His

Product name ARO-P12136-100
Uniprot ID P09661
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAR
Molecular weight 22.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg176
Aliases /Synonyms U2 small nuclear ribonucleoprotein A', SNRPA1, U2 snRNP A'
Reference ARO-P12136
Note For research use only.
Molecular Constructor
Met1–Arg176
Product name ARO-P12136-1MG
Uniprot ID P09661
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAR
Molecular weight 22.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg176
Aliases /Synonyms U2 small nuclear ribonucleoprotein A', SNRPA1, U2 snRNP A'
Reference ARO-P12136
Note For research use only.
Molecular Constructor
Met1–Arg176
Product name ARO-P12136-50
Uniprot ID P09661
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAR
Molecular weight 22.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg176
Aliases /Synonyms U2 small nuclear ribonucleoprotein A', SNRPA1, U2 snRNP A'
Reference ARO-P12136
Note For research use only.
Molecular Constructor
Met1–Arg176

Introduction

Recombinant Human SNRPA1 Protein is a highly versatile and vital protein that plays a crucial role in various cellular processes. It is a recombinant protein that is produced through genetic engineering techniques, making it a valuable tool in scientific research and biotechnology. In this article, we will discuss the structure, activity, and applications of Recombinant Human SNRPA1 Protein.

Structure of Recombinant Human SNRPA1 Protein

Recombinant Human SNRPA1 Protein is a 28 kDa protein that is composed of 240 amino acids. It is a member of the small nuclear ribonucleoprotein (snRNP) family and is also known as U1 small nuclear ribonucleoprotein A (U1A). The protein is composed of two domains, an N-terminal RNA binding domain and a C-terminal dimerization domain. The RNA binding domain is responsible for binding to specific RNA sequences, while the dimerization domain is involved in protein-protein interactions.

Activity of Recombinant Human SNRPA1 Protein

Recombinant Human SNRPA1 Protein is a key component of the spliceosome, a complex responsible for removing introns from pre-mRNA. It binds to the U1 small nuclear RNA (snRNA) and forms a complex with other proteins to form the U1 snRNP. This complex then binds to the 5′ splice site of the pre-mRNA, initiating the splicing process.

In addition to its role in splicing, Recombinant Human SNRPA1 Protein also plays a role in other cellular processes such as mRNA export, transcription, and translation. It has been shown to interact with various proteins involved in these processes, indicating its diverse functions in the cell.

Applications of Recombinant Human SNRPA1 Protein

Recombinant Human SNRPA1 Protein has a wide range of applications in both basic research and biotechnology. Its ability to bind specific RNA sequences makes it a valuable tool for studying RNA processing and regulation. It is commonly used in in vitro splicing assays to study the mechanism of splicing and identify potential splicing inhibitors.

In the biotechnology industry, Recombinant Human SNRPA1 Protein is used in the production of recombinant proteins. It is often fused with a target protein to enhance its stability and solubility, making it easier to purify and study. Additionally, its ability to bind specific RNA sequences has been utilized in the development of RNA-based therapeutic approaches.

Moreover, Recombinant Human SNRPA1 Protein has been implicated in various diseases, including cancer and autoimmune disorders. Its role in mRNA export and translation regulation suggests that it may play a role in disease progression. Therefore, it is a potential target for drug development and therapeutic interventions.

Conclusion

In summary, Recombinant Human SNRPA1 Protein is a critical component of the spliceosome and plays a crucial role in various cellular processes. Its structure, activity, and applications make it a valuable tool in scientific research and biotechnology. With its potential role in disease and therapeutic applications, this protein continues to be an important focus of study in the scientific community.

Recombinant Human SNRPA1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SNRPA1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products