Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLC2A14 Protein, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8TDB8
Molecular weight:
32.65 kDa

Original price was: €253.00.Current price is: €228.00.

50ug 10% OFF + 228 loyalty points
GST Asn51–Val105
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLC2A14 Protein, N-GST

Product name ARO-P15287-100
Uniprot ID Q8TDB8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NTGVINAPETIIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSV
Molecular weight 32.65 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn51-Val105
Aliases /Synonyms SLC2A14, GLUT-14, Solute carrier family 2, facilitated glucose transporter member 14, Glucose transporter type 14, GLUT14
Reference ARO-P15287
Note For research use only.
Molecular Constructor
GST Asn51–Val105
Product name ARO-P15287-1MG
Uniprot ID Q8TDB8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NTGVINAPETIIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSV
Molecular weight 32.65 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn51-Val105
Aliases /Synonyms SLC2A14, GLUT-14, Solute carrier family 2, facilitated glucose transporter member 14, Glucose transporter type 14, GLUT14
Reference ARO-P15287
Note For research use only.
Molecular Constructor
GST Asn51–Val105
Product name ARO-P15287-50
Uniprot ID Q8TDB8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NTGVINAPETIIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSV
Molecular weight 32.65 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn51-Val105
Aliases /Synonyms SLC2A14, GLUT-14, Solute carrier family 2, facilitated glucose transporter member 14, Glucose transporter type 14, GLUT14
Reference ARO-P15287
Note For research use only.
Molecular Constructor
GST Asn51–Val105

There are no reviews yet.

Be the first to review “Recombinant Human SLC2A14 Protein, N-GST”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products